95Jer'Zhan Newton
  • PositionDefensive Tackle
  • Height6' 2"
  • Weight295 lbs
  • Age24
  • Experience3 yrs
  • CollegeIllinois
Washington Commanders · Defensive Tackle

Jer'Zhan Newton

♍Virgo sun · Aug 23 - Sep 22EarthCosmic energy★★★★★

Jer'Zhan Newton is a Virgo, born August 31, 2002, with a Taurus moon and Capricorn mercury. Disciplined, low-penalty football and clean route running rule the week.

Sun♍VirgoMoon♉TaurusMercury♑CapricornMars♋Cancer
Surgical with assignmentsSweats the film detailsDisciplined, low-penalty football and clean route running rule the week.Cosmic energy is just for fun.

Jer'Zhan's matchups

Scored against all four placements, not just the sun

Best teammates

Daron PayneNT · Washington Commanders · ♊ Gemini63 Workable chemistryNick CrossSS · Washington Commanders · ♍ Virgo81 Strong synergyJeremy ReavesFS · Washington Commanders · ♍ Virgo68 Workable chemistry

Teammate frustrations

Sam CosmiRG · Washington Commanders · ♒ Aquarius57 Crossed wiresStefon DiggsWR · Washington Commanders · ♐ Sagittarius60 Uneasy orbitJacory Croskey-MerrittRB · Washington Commanders · ♈ Aries63 Uneasy orbit

Mortal enemies

Tyler BookerRG · Dallas Cowboys · ♈ Aries45 Stars at warWillie LampkinLG · Philadelphia Eagles · ♒ Aquarius51 Crossed wiresFrancis MauigoaRG · New York Giants · ♊ Gemini56 Crossed wires

Jer'Zhan's chart, read out

Jer'Zhan Newton is a Virgo, born August 31, 2002. That makes him a Mutable Earth sign, Aug 23 - Sep 22. His chart reads Virgo sun, Taurus moon, Capricorn mercury, Cancer mars. Jer'Zhan settles rather than spikes under pressure, holding the same tempo in the fourth quarter as the first. Jer'Zhan builds the drive in sequence and rarely takes the shot before the setup is in place. Jer'Zhan plays hardest when protecting someone, whether that is a quarterback or a lead. Read together, that is the shape of a Virgo in the trenches for the Washington Commanders.

Jer'Zhan Newton: frequently asked

What is Jer'Zhan Newton's zodiac sign?

Jer'Zhan Newton is a Virgo, born August 31, 2002. Virgo runs Aug 23 - Sep 22 and is an Earth sign.

What is Jer'Zhan Newton's moon sign?

Jer'Zhan Newton has a Taurus moon, calculated from his August 31, 2002 birthday. The moon describes how a player is wired when a play breaks down: Jer'Zhan settles rather than spikes under pressure, holding the same tempo in the fourth quarter as the first.

What is Jer'Zhan Newton's mercury sign?

Jer'Zhan Newton has Capricorn mercury, the placement that describes how he processes the game. Jer'Zhan builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Jer'Zhan Newton's mars sign?

Jer'Zhan Newton has Cancer mars, which describes how the physical effort arrives. Jer'Zhan plays hardest when protecting someone, whether that is a quarterback or a lead.

How does being a Virgo show up in the trenches?

Virgo reads as: Surgical with assignments; Sweats the film details. For Jer'Zhan Newton in the trenches with the Washington Commanders, that is the baseline the rest of the chart adjusts. In his case mars is in Cancer: Jer'Zhan plays hardest when protecting someone, whether that is a quarterback or a lead.

NFL stats

Defense · 2 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
2024164419252112000.00017100
2025173821175100000.00014.521
Career338240427212000.000211.5121