41Jake Golday
  • PositionLinebacker
  • Height6' 4"
  • Weight240 lbs
  • Age23
  • ExperienceRookie
  • CollegeCincinnati
Minnesota Vikings · Linebacker

Jake Golday

♊Gemini sun · May 21 - Jun 20AirCosmic energy★★★★★

Jake Golday is a Gemini, born May 23, 2003, with a Aquarius moon and Capricorn mercury. Look for trick plays, motion, and a playbook that keeps defenses guessing.

Sun♊GeminiMoon♒AquariusMercury♑CapricornMars♐Sagittarius
Reads two routes at onceQuick to improviseLook for trick plays, motion, and a playbook that keeps defenses guessing.Cosmic energy is just for fun.

Jake's matchups

Scored against all four placements, not just the sun

Best teammates

Caleb BanksNT · Minnesota Vikings · ♓ Pisces58 Tense aspectsHarrison SmithFS · Minnesota Vikings · ♒ Aquarius76 Workable chemistryJoshua MetellusSS · Minnesota Vikings · ♒ Aquarius76 Workable chemistry

Teammate frustrations

Brian O'NeillRT · Minnesota Vikings · ♍ Virgo51 Crossed wiresT.J. HockensonTE · Minnesota Vikings · ♋ Cancer51 Crossed wiresJauan JenningsWR · Minnesota Vikings · ♋ Cancer63 Uneasy orbit

Mortal enemies

Jahmyr GibbsRB · Detroit Lions · ♓ Pisces51 Crossed wiresD'Andre SwiftRB · Chicago Bears · ♑ Capricorn56 Crossed wiresSam LaPortaTE · Detroit Lions · ♑ Capricorn56 Crossed wires

Jake's chart, read out

Jake Golday is a Gemini, born May 23, 2003. That makes him a Mutable Air sign, May 21 - Jun 20. His chart reads Gemini sun, Aquarius moon, Capricorn mercury, Sagittarius mars. Jake detaches from the noise and sees the down as a problem to solve rather than a fight to win. Jake builds the drive in sequence and rarely takes the shot before the setup is in place. Jake plays with range, covering ground others need an extra step to reach. Read together, that is the shape of a Gemini at linebacker for the Minnesota Vikings.

Jake Golday: frequently asked

What is Jake Golday's zodiac sign?

Jake Golday is a Gemini, born May 23, 2003. Gemini runs May 21 - Jun 20 and is an Air sign.

What is Jake Golday's moon sign?

Jake Golday has an Aquarius moon, calculated from his May 23, 2003 birthday. The moon describes how a player is wired when a play breaks down: Jake detaches from the noise and sees the down as a problem to solve rather than a fight to win.

What is Jake Golday's mercury sign?

Jake Golday has Capricorn mercury, the placement that describes how he processes the game. Jake builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Jake Golday's mars sign?

Jake Golday has Sagittarius mars, which describes how the physical effort arrives. Jake plays with range, covering ground others need an extra step to reach.

How does being a Gemini show up at linebacker?

Gemini reads as: Reads two routes at once; Quick to improvise. For Jake Golday at linebacker with the Minnesota Vikings, that is the baseline the rest of the chart adjusts. In his case mars is in Sagittarius: Jake plays with range, covering ground others need an extra step to reach.

NFL stats

Defense · 1 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
202657520200000.0000000
Career57520200000.0000000