35Jalen McLeod
  • PositionLinebacker
  • Height6' 1"
  • Weight236 lbs
  • Age24
  • Experience2 yrs
  • CollegeAuburn
Jacksonville Jaguars · Linebacker

Jalen McLeod

♊Gemini sun · May 21 - Jun 20AirCosmic energy★★★★★

Jalen McLeod is a Gemini, born June 5, 2002, with a Pisces moon and Capricorn mercury. Look for trick plays, motion, and a playbook that keeps defenses guessing.

Sun♊GeminiMoon♓PiscesMercury♑CapricornMars♊Gemini
Reads two routes at onceQuick to improviseLook for trick plays, motion, and a playbook that keeps defenses guessing.Cosmic energy is just for fun.

Jalen's matchups

Scored against all four placements, not just the sun

Best teammates

Antonio JohnsonFS · Jacksonville Jaguars · ♏ Scorpio60 Workable chemistryEric MurraySS · Jacksonville Jaguars · ♑ Capricorn51 Tense aspectsVentrell MillerMLB · Jacksonville Jaguars · ♑ Capricorn68 Workable chemistry

Teammate frustrations

Brenton StrangeTE · Jacksonville Jaguars · ♑ Capricorn45 Stars at warCole Van LanenRT · Jacksonville Jaguars · ♉ Taurus59 Crossed wiresJakobi MeyersWR · Jacksonville Jaguars · ♏ Scorpio61 Uneasy orbit

Mortal enemies

Gunnar HelmTE · Tennessee Titans · ♍ Virgo51 Crossed wiresTony PollardRB · Tennessee Titans · ♉ Taurus51 Crossed wiresJonathan TaylorRB · Indianapolis Colts · ♑ Capricorn55 Crossed wires

Jalen's chart, read out

Jalen McLeod is a Gemini, born June 5, 2002. That makes him a Mutable Air sign, May 21 - Jun 20. His chart reads Gemini sun, Pisces moon, Capricorn mercury, Gemini mars. Jalen feels the flow of a game before the numbers show it, and plays the version of the down that is actually happening. Jalen builds the drive in sequence and rarely takes the shot before the setup is in place. Jalen wins with quickness and change of direction instead of raw force. Read together, that is the shape of a Gemini at linebacker for the Jacksonville Jaguars.

Jalen McLeod: frequently asked

What is Jalen McLeod's zodiac sign?

Jalen McLeod is a Gemini, born June 5, 2002. Gemini runs May 21 - Jun 20 and is an Air sign.

What is Jalen McLeod's moon sign?

Jalen McLeod has a Pisces moon, calculated from his June 5, 2002 birthday. The moon describes how a player is wired when a play breaks down: Jalen feels the flow of a game before the numbers show it, and plays the version of the down that is actually happening.

What is Jalen McLeod's mercury sign?

Jalen McLeod has Capricorn mercury, the placement that describes how he processes the game. Jalen builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Jalen McLeod's mars sign?

Jalen McLeod has Gemini mars, which describes how the physical effort arrives. Jalen wins with quickness and change of direction instead of raw force.

How does being a Gemini show up at linebacker?

Gemini reads as: Reads two routes at once; Quick to improvise. For Jalen McLeod at linebacker with the Jacksonville Jaguars, that is the baseline the rest of the chart adjusts. In his case mars is in Gemini: Jalen wins with quickness and change of direction instead of raw force.

NFL stats

Defense · 1 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
202657520000000.0000000
Career46510000000.0000000