29Jalon Kilgore
  • PositionSafety
  • Height6' 1"
  • Weight210 lbs
  • Age21
  • ExperienceRookie
  • CollegeSouth Carolina
Buffalo Bills · Safety

Jalon Kilgore

♒Aquarius sun · Jan 20 - Feb 18AirCosmic energy★★★★★

Jalon Kilgore is a Aquarius, born January 27, 2005, with a Leo moon and Capricorn mercury. Unconventional looks and creative play-calling steal the show.

Sun♒AquariusMoon♌LeoMercury♑CapricornMars♏Scorpio
Innovates the schemeSees the field differentlyUnconventional looks and creative play-calling steal the show.Cosmic energy is just for fun.

Jalon's matchups

Scored against all four placements, not just the sun

Best teammates

C.J. Gardner-JohnsonFS · Buffalo Bills · ♐ Sagittarius88 Strong synergyCole BishopSS · Buffalo Bills · ♏ Scorpio51 Tense aspectsDeone WalkerNT · Buffalo Bills · ♓ Pisces68 Workable chemistry

Teammate frustrations

Keon ColemanWR · Buffalo Bills · ♉ Taurus49 Crossed wiresConnor McGovernC · Buffalo Bills · ♏ Scorpio55 Crossed wiresSpencer BrownRT · Buffalo Bills · ♓ Pisces58 Crossed wires

Mortal enemies

Garrett WilsonWR · New York Jets · ♋ Cancer45 Stars at warKenyon SadiqTE · New York Jets · ♓ Pisces49 Crossed wiresCaleb DouglasWR · Miami Dolphins · ♍ Virgo56 Crossed wires

Jalon's chart, read out

Jalon Kilgore is an Aquarius, born January 27, 2005. That makes him a Fixed Air sign, Jan 20 - Feb 18. His chart reads Aquarius sun, Leo moon, Capricorn mercury, Scorpio mars. Jalon needs the moment to matter, and finds another gear once the cameras find him. Jalon builds the drive in sequence and rarely takes the shot before the setup is in place. Jalon finishes every rep through the whistle and plays with a grudge. Read together, that is the shape of an Aquarius in the secondary for the Buffalo Bills.

Jalon Kilgore: frequently asked

What is Jalon Kilgore's zodiac sign?

Jalon Kilgore is an Aquarius, born January 27, 2005. Aquarius runs Jan 20 - Feb 18 and is an Air sign.

What is Jalon Kilgore's moon sign?

Jalon Kilgore has a Leo moon, calculated from his January 27, 2005 birthday. The moon describes how a player is wired when a play breaks down: Jalon needs the moment to matter, and finds another gear once the cameras find him.

What is Jalon Kilgore's mercury sign?

Jalon Kilgore has Capricorn mercury, the placement that describes how he processes the game. Jalon builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Jalon Kilgore's mars sign?

Jalon Kilgore has Scorpio mars, which describes how the physical effort arrives. Jalon finishes every rep through the whistle and plays with a grudge.

How does being an Aquarius show up in the secondary?

Aquarius reads as: Innovates the scheme; Sees the field differently. For Jalon Kilgore in the secondary with the Buffalo Bills, that is the baseline the rest of the chart adjusts. In his case mars is in Scorpio: Jalon finishes every rep through the whistle and plays with a grudge.

NFL stats

Defense · 1 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
202621100000000.0000000
Career11100000000.0000000