66Connor McGovern
  • PositionCenter
  • Height6' 6"
  • Weight318 lbs
  • Age28
  • Experience8 yrs
  • CollegePenn State
Buffalo Bills · Center

Connor McGovern

♏Scorpio sun · Oct 24 - Nov 21WaterCosmic energy★★★★★

Connor McGovern is a Scorpio, born November 3, 1997, with a Scorpio moon and Capricorn mercury. Defenses bring the heat. Watch for takeaways and intensity.

Sun♏ScorpioMoon♏ScorpioMercury♑CapricornMars♑Capricorn
Relentless on the blitzNever lets a grudge goDefenses bring the heat. Watch for takeaways and intensity.Cosmic energy is just for fun.

Connor's matchups

Scored against all four placements, not just the sun

Best teammates

Josh AllenQB · Buffalo Bills · ♊ Gemini51 Tense aspectsO'Cyrus TorrenceRG · Buffalo Bills · ♒ Aquarius56 Tense aspectsAlec AndersonLG · Buffalo Bills · ♎ Libra49 Tense aspects

Teammate frustrations

James Cook IIIRB · Buffalo Bills · ♎ Libra68 Uneasy orbitDalton KincaidTE · Buffalo Bills · ♎ Libra61 Uneasy orbitKhalil ShakirWR · Buffalo Bills · ♒ Aquarius57 Crossed wires

Mortal enemies

Cory DurdenNT · New England Patriots · ♒ Aquarius56 Crossed wiresJacob RodriguezMLB · Miami Dolphins · ♍ Virgo68 Uneasy orbitJamien SherwoodMLB · New York Jets · ♑ Capricorn86 Surprisingly civil

Connor's chart, read out

Connor McGovern is a Scorpio, born November 3, 1997. That makes him a Fixed Water sign, Oct 24 - Nov 21. His chart reads Scorpio sun, Scorpio moon, Capricorn mercury, Capricorn mars. Connor keeps score privately, files away every rep he lost, and collects on it later. Connor builds the drive in sequence and rarely takes the shot before the setup is in place. Connor grinds and outlasts, wearing down an opponent across four quarters rather than one snap. Read together, that is the shape of a Scorpio in the trenches for the Buffalo Bills.

Connor McGovern: frequently asked

What is Connor McGovern's zodiac sign?

Connor McGovern is a Scorpio, born November 3, 1997. Scorpio runs Oct 24 - Nov 21 and is a Water sign.

What is Connor McGovern's moon sign?

Connor McGovern has a Scorpio moon, calculated from his November 3, 1997 birthday. The moon describes how a player is wired when a play breaks down: Connor keeps score privately, files away every rep he lost, and collects on it later.

What is Connor McGovern's mercury sign?

Connor McGovern has Capricorn mercury, the placement that describes how he processes the game. Connor builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Connor McGovern's mars sign?

Connor McGovern has Capricorn mars, which describes how the physical effort arrives. Connor grinds and outlasts, wearing down an opponent across four quarters rather than one snap.

How does being a Scorpio show up in the trenches?

Scorpio reads as: Relentless on the blitz; Never lets a grudge go. For Connor McGovern in the trenches with the Buffalo Bills, that is the baseline the rest of the chart adjusts. In his case mars is in Capricorn: Connor grinds and outlasts, wearing down an opponent across four quarters rather than one snap.

NFL stats

Defense · 2 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
2022151100000000.0000000
2023172200000000.0000000
Career323300000000.0000000