23Trey Amos
  • PositionCornerback
  • Height6' 1"
  • Weight190 lbs
  • Age24
  • Experience2 yrs
  • CollegeOle Miss
Washington Commanders · Cornerback

Trey Amos

♓Pisces sun · Feb 19 - Mar 20WaterCosmic energy★★★★★

Trey Amos is a Pisces, born March 3, 2002, with a Virgo moon and Capricorn mercury. Intuition over structure: improvised magic when the play breaks down.

Sun♓PiscesMoon♍VirgoMercury♑CapricornMars♈Aries
Feels the flow of the gameInstinctive playmakerIntuition over structure: improvised magic when the play breaks down.Cosmic energy is just for fun.

Trey's matchups

Scored against all four placements, not just the sun

Best teammates

Nick CrossSS · Washington Commanders · ♍ Virgo84 Strong synergyJeremy ReavesFS · Washington Commanders · ♍ Virgo68 Workable chemistryDaron PayneNT · Washington Commanders · ♊ Gemini69 Workable chemistry

Teammate frustrations

Sam CosmiRG · Washington Commanders · ♒ Aquarius51 Crossed wiresJacory Croskey-MerrittRB · Washington Commanders · ♈ Aries56 Crossed wiresJayden DanielsQB · Washington Commanders · ♐ Sagittarius58 Crossed wires

Mortal enemies

Malik NabersWR · New York Giants · ♌ Leo45 Stars at warCeeDee LambWR · Dallas Cowboys · ♈ Aries51 Crossed wiresMakai LemonWR · Philadelphia Eagles · ♊ Gemini51 Crossed wires

Trey's chart, read out

Trey Amos is a Pisces, born March 3, 2002. That makes him a Mutable Water sign, Feb 19 - Mar 20. His chart reads Pisces sun, Virgo moon, Capricorn mercury, Aries mars. Trey replays the one bad rep long after the film session ends, which is both the flaw and the engine. Trey builds the drive in sequence and rarely takes the shot before the setup is in place. Trey attacks downhill with no wind-up, first off the ball more often than not. Read together, that is the shape of a Pisces in the secondary for the Washington Commanders.

Trey Amos: frequently asked

What is Trey Amos's zodiac sign?

Trey Amos is a Pisces, born March 3, 2002. Pisces runs Feb 19 - Mar 20 and is a Water sign.

What is Trey Amos's moon sign?

Trey Amos has a Virgo moon, calculated from his March 3, 2002 birthday. The moon describes how a player is wired when a play breaks down: Trey replays the one bad rep long after the film session ends, which is both the flaw and the engine.

What is Trey Amos's mercury sign?

Trey Amos has Capricorn mercury, the placement that describes how he processes the game. Trey builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Trey Amos's mars sign?

Trey Amos has Aries mars, which describes how the physical effort arrives. Trey attacks downhill with no wind-up, first off the ball more often than not.

How does being a Pisces show up in the secondary?

Pisces reads as: Feels the flow of the game; Instinctive playmaker. For Trey Amos in the secondary with the Washington Commanders, that is the baseline the rest of the chart adjusts. In his case mars is in Aries: Trey attacks downhill with no wind-up, first off the ball more often than not.

NFL stats

Defense · 1 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
2025103219130000000.0006120
Career103219130000000.0006120