54Dorian Mausi
  • PositionLinebacker
  • Height6' 1"
  • Weight234 lbs
  • Age24
  • Experience2 yrs
  • CollegeAuburn
Tennessee Titans · Linebacker

Dorian Mausi

♓Pisces sun · Feb 19 - Mar 20WaterCosmic energy★★★★★

Dorian Mausi is a Pisces, born March 5, 2002, with a Scorpio moon and Capricorn mercury. Intuition over structure: improvised magic when the play breaks down.

Sun♓PiscesMoon♏ScorpioMercury♑CapricornMars♈Aries
Feels the flow of the gameInstinctive playmakerIntuition over structure: improvised magic when the play breaks down.Cosmic energy is just for fun.

Dorian's matchups

Scored against all four placements, not just the sun

Best teammates

Kevin Winston Jr.FS · Tennessee Titans · ♐ Sagittarius58 Tense aspectsAmani HookerSS · Tennessee Titans · ♊ Gemini51 Tense aspectsAnthony Hill Jr.MLB · Tennessee Titans · ♒ Aquarius45 Tense aspects

Teammate frustrations

Cam WardQB · Tennessee Titans · ♊ Gemini51 Crossed wiresJC LathamRT · Tennessee Titans · ♒ Aquarius56 Crossed wiresElic AyomanorWR · Tennessee Titans · ♊ Gemini57 Crossed wires

Mortal enemies

Bhayshul TutenRB · Jacksonville Jaguars · ♒ Aquarius51 Crossed wiresDavid MontgomeryRB · Houston Texans · ♊ Gemini57 Crossed wiresTyler WarrenTE · Indianapolis Colts · ♊ Gemini62 Uneasy orbit

Dorian's chart, read out

Dorian Mausi is a Pisces, born March 5, 2002. That makes him a Mutable Water sign, Feb 19 - Mar 20. His chart reads Pisces sun, Scorpio moon, Capricorn mercury, Aries mars. Dorian keeps score privately, files away every rep he lost, and collects on it later. Dorian builds the drive in sequence and rarely takes the shot before the setup is in place. Dorian attacks downhill with no wind-up, first off the ball more often than not. Read together, that is the shape of a Pisces at linebacker for the Tennessee Titans.

Dorian Mausi: frequently asked

What is Dorian Mausi's zodiac sign?

Dorian Mausi is a Pisces, born March 5, 2002. Pisces runs Feb 19 - Mar 20 and is a Water sign.

What is Dorian Mausi's moon sign?

Dorian Mausi has a Scorpio moon, calculated from his March 5, 2002 birthday. The moon describes how a player is wired when a play breaks down: Dorian keeps score privately, files away every rep he lost, and collects on it later.

What is Dorian Mausi's mercury sign?

Dorian Mausi has Capricorn mercury, the placement that describes how he processes the game. Dorian builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Dorian Mausi's mars sign?

Dorian Mausi has Aries mars, which describes how the physical effort arrives. Dorian attacks downhill with no wind-up, first off the ball more often than not.

How does being a Pisces show up at linebacker?

Pisces reads as: Feels the flow of the game; Instinctive playmaker. For Dorian Mausi at linebacker with the Tennessee Titans, that is the baseline the rest of the chart adjusts. In his case mars is in Aries: Dorian attacks downhill with no wind-up, first off the ball more often than not.

NFL stats

Defense · 1 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
2025179540010000.0000000
Career179540010000.0000000