69Cody Mauch
  • PositionGuard
  • Height6' 6"
  • Weight303 lbs
  • Age27
  • Experience4 yrs
  • CollegeNorth Dakota State
Tampa Bay Buccaneers · Guard

Cody Mauch

♑Capricorn sun · Dec 22 - Jan 19EarthCosmic energy★★★★★

Cody Mauch is a Capricorn, born January 15, 1999, with a Scorpio moon and Capricorn mercury. Clock-control football and fourth-quarter composure carry the week.

Sun♑CapricornMoon♏ScorpioMercury♑CapricornMars♌Leo
Methodical drive-builderCloses out gamesClock-control football and fourth-quarter composure carry the week.Cosmic energy is just for fun.

Cody's matchups

Scored against all four placements, not just the sun

Best teammates

Luke GoedekeRT · Tampa Bay Buccaneers · ♏ Scorpio83 Strong synergyGraham BartonC · Tampa Bay Buccaneers · ♊ Gemini55 Tense aspectsBaker MayfieldQB · Tampa Bay Buccaneers · ♈ Aries67 Workable chemistry

Teammate frustrations

Bucky IrvingRB · Tampa Bay Buccaneers · ♌ Leo45 Stars at warTristan WirfsLT · Tampa Bay Buccaneers · ♒ Aquarius62 Uneasy orbitCade OttonTE · Tampa Bay Buccaneers · ♈ Aries68 Uneasy orbit

Mortal enemies

Gervon Dexter Sr.NT · Atlanta Falcons · ♎ Libra45 Stars at warNathan ShepherdNT · New Orleans Saints · ♎ Libra45 Stars at warLee HunterNT · Carolina Panthers · ♋ Cancer92 Surprisingly civil

Cody's chart, read out

Cody Mauch is a Capricorn, born January 15, 1999. That makes him a Cardinal Earth sign, Dec 22 - Jan 19. His chart reads Capricorn sun, Scorpio moon, Capricorn mercury, Leo mars. Cody keeps score privately, files away every rep he lost, and collects on it later. Cody builds the drive in sequence and rarely takes the shot before the setup is in place. Cody saves the biggest effort for the biggest snap, which makes the highlights and the tape disagree. Read together, that is the shape of a Capricorn in the trenches for the Tampa Bay Buccaneers.

Cody Mauch: frequently asked

What is Cody Mauch's zodiac sign?

Cody Mauch is a Capricorn, born January 15, 1999. Capricorn runs Dec 22 - Jan 19 and is an Earth sign.

What is Cody Mauch's moon sign?

Cody Mauch has a Scorpio moon, calculated from his January 15, 1999 birthday. The moon describes how a player is wired when a play breaks down: Cody keeps score privately, files away every rep he lost, and collects on it later.

What is Cody Mauch's mercury sign?

Cody Mauch has Capricorn mercury, the placement that describes how he processes the game. Cody builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Cody Mauch's mars sign?

Cody Mauch has Leo mars, which describes how the physical effort arrives. Cody saves the biggest effort for the biggest snap, which makes the highlights and the tape disagree.

How does being a Capricorn show up in the trenches?

Capricorn reads as: Methodical drive-builder; Closes out games. For Cody Mauch in the trenches with the Tampa Bay Buccaneers, that is the baseline the rest of the chart adjusts. In his case mars is in Leo: Cody saves the biggest effort for the biggest snap, which makes the highlights and the tape disagree.

NFL stats

Defense · 1 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
202321100000000.0000000
Career21100000000.0000000