57Connor O'Toole
  • PositionLinebacker
  • Height6' 3"
  • Weight248 lbs
  • Age24
  • Experience2 yrs
  • CollegeUtah
Seattle Seahawks · Linebacker

Connor O'Toole

♍Virgo sun · Aug 23 - Sep 22EarthCosmic energy★★★★★

Connor O'Toole is a Virgo, born August 27, 2002, with a Pisces moon and Capricorn mercury. Disciplined, low-penalty football and clean route running rule the week.

Sun♍VirgoMoon♓PiscesMercury♑CapricornMars♋Cancer
Surgical with assignmentsSweats the film detailsDisciplined, low-penalty football and clean route running rule the week.Cosmic energy is just for fun.

Connor's matchups

Scored against all four placements, not just the sun

Best teammates

Byron Murphy IINT · Seattle Seahawks · ♍ Virgo74 Workable chemistryJulian LoveFS · Seattle Seahawks · ♓ Pisces92 Cosmic alignmentTy OkadaSS · Seattle Seahawks · ♊ Gemini63 Workable chemistry

Teammate frustrations

Charles CrossLT · Seattle Seahawks · ♐ Sagittarius51 Crossed wiresChristian HaynesRG · Seattle Seahawks · ♈ Aries51 Crossed wiresJaxon Smith-NjigbaWR · Seattle Seahawks · ♒ Aquarius54 Crossed wires

Mortal enemies

Christian McCaffreyRB · San Francisco 49ers · ♊ Gemini51 Crossed wiresGeorge KittleTE · San Francisco 49ers · ♎ Libra51 Crossed wiresTrey McBrideTE · Arizona Cardinals · ♐ Sagittarius51 Crossed wires

Connor's chart, read out

Connor O'Toole is a Virgo, born August 27, 2002. That makes him a Mutable Earth sign, Aug 23 - Sep 22. His chart reads Virgo sun, Pisces moon, Capricorn mercury, Cancer mars. Connor feels the flow of a game before the numbers show it, and plays the version of the down that is actually happening. Connor builds the drive in sequence and rarely takes the shot before the setup is in place. Connor plays hardest when protecting someone, whether that is a quarterback or a lead. Read together, that is the shape of a Virgo at linebacker for the Seattle Seahawks.

Connor O'Toole: frequently asked

What is Connor O'Toole's zodiac sign?

Connor O'Toole is a Virgo, born August 27, 2002. Virgo runs Aug 23 - Sep 22 and is an Earth sign.

What is Connor O'Toole's moon sign?

Connor O'Toole has a Pisces moon, calculated from his August 27, 2002 birthday. The moon describes how a player is wired when a play breaks down: Connor feels the flow of a game before the numbers show it, and plays the version of the down that is actually happening.

What is Connor O'Toole's mercury sign?

Connor O'Toole has Capricorn mercury, the placement that describes how he processes the game. Connor builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Connor O'Toole's mars sign?

Connor O'Toole has Cancer mars, which describes how the physical effort arrives. Connor plays hardest when protecting someone, whether that is a quarterback or a lead.

How does being a Virgo show up at linebacker?

Virgo reads as: Surgical with assignments; Sweats the film details. For Connor O'Toole at linebacker with the Seattle Seahawks, that is the baseline the rest of the chart adjusts. In his case mars is in Cancer: Connor plays hardest when protecting someone, whether that is a quarterback or a lead.

NFL stats

Defense · 2 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
202585320010000.0000000
202643120010000.0000000
Career128440020000.0000000