96James Thompson Jr.
  • PositionDefensive Tackle
  • Height6' 6"
  • Weight308 lbs
  • Age24
  • ExperienceRookie
  • CollegeIllinois
San Francisco 49ers · Defensive Tackle

James Thompson Jr.

♍Virgo sun · Aug 23 - Sep 22EarthCosmic energy★★★★★

James Thompson Jr. is a Virgo, born August 29, 2002, with a Aries moon and Capricorn mercury. Disciplined, low-penalty football and clean route running rule the week.

Sun♍VirgoMoon♈AriesMercury♑CapricornMars♋Cancer
Surgical with assignmentsSweats the film detailsDisciplined, low-penalty football and clean route running rule the week.Cosmic energy is just for fun.

James's matchups

Scored against all four placements, not just the sun

Best teammates

Fred WarnerMLB · San Francisco 49ers · ♏ Scorpio88 Strong synergyMarques SigleSS · San Francisco 49ers · ♋ Cancer78 Workable chemistryJi'Ayir BrownFS · San Francisco 49ers · ♒ Aquarius51 Tense aspects

Teammate frustrations

Brandin CooksWR · San Francisco 49ers · ♎ Libra45 Stars at warMike EvansWR · San Francisco 49ers · ♌ Leo45 Stars at warColton McKivitzRT · San Francisco 49ers · ♌ Leo56 Crossed wires

Mortal enemies

Coleman SheltonC · Los Angeles Rams · ♌ Leo45 Stars at warGrey ZabelLG · Seattle Seahawks · ♈ Aries51 Crossed wiresJalen SundellC · Seattle Seahawks · ♎ Libra51 Crossed wires

James's chart, read out

James Thompson Jr. is a Virgo, born August 29, 2002. That makes him a Mutable Earth sign, Aug 23 - Sep 22. His chart reads Virgo sun, Aries moon, Capricorn mercury, Cancer mars. James runs on instinct when a play breaks down, and would rather be wrong at full speed than right a beat late. James builds the drive in sequence and rarely takes the shot before the setup is in place. James plays hardest when protecting someone, whether that is a quarterback or a lead. Read together, that is the shape of a Virgo in the trenches for the San Francisco 49ers.

James Thompson Jr.: frequently asked

What is James Thompson Jr.'s zodiac sign?

James Thompson Jr. is a Virgo, born August 29, 2002. Virgo runs Aug 23 - Sep 22 and is an Earth sign.

What is James Thompson Jr.'s moon sign?

James Thompson Jr. has an Aries moon, calculated from his August 29, 2002 birthday. The moon describes how a player is wired when a play breaks down: James runs on instinct when a play breaks down, and would rather be wrong at full speed than right a beat late.

What is James Thompson Jr.'s mercury sign?

James Thompson Jr. has Capricorn mercury, the placement that describes how he processes the game. James builds the drive in sequence and rarely takes the shot before the setup is in place.

What is James Thompson Jr.'s mars sign?

James Thompson Jr. has Cancer mars, which describes how the physical effort arrives. James plays hardest when protecting someone, whether that is a quarterback or a lead.

How does being a Virgo show up in the trenches?

Virgo reads as: Surgical with assignments; Sweats the film details. For James Thompson Jr. in the trenches with the San Francisco 49ers, that is the baseline the rest of the chart adjusts. In his case mars is in Cancer: James plays hardest when protecting someone, whether that is a quarterback or a lead.

NFL stats

Defense · 1 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
202624130000000.0000000
Career24130000000.0000000