23Daylen Everette
  • PositionCornerback
  • Height6' 1"
  • Weight196 lbs
  • Age22
  • ExperienceRookie
  • CollegeGeorgia
Pittsburgh Steelers · Cornerback

Daylen Everette

♉Taurus sun · Apr 20 - May 20EarthCosmic energy★★★★★

Daylen Everette is a Taurus, born May 6, 2004, with a Scorpio moon and Capricorn mercury. A week to lean on the run game and wear opponents down.

Sun♉TaurusMoon♏ScorpioMercury♑CapricornMars♊Gemini
Immovable in the trenchesGrinds out the tough yardsA week to lean on the run game and wear opponents down.Cosmic energy is just for fun.

Daylen's matchups

Scored against all four placements, not just the sun

Best teammates

Jaquan BriskerFS · Pittsburgh Steelers · ♉ Taurus80 Strong synergyRobert Spears-JenningsSS · Pittsburgh Steelers · ♒ Aquarius69 Workable chemistryKeeanu BentonNT · Pittsburgh Steelers · ♋ Cancer91 Cosmic alignment

Teammate frustrations

Mason McCormickLG · Pittsburgh Steelers · ♊ Gemini45 Stars at warDarnell WashingtonTE · Pittsburgh Steelers · ♌ Leo58 Crossed wiresGermie BernardWR · Pittsburgh Steelers · ♐ Sagittarius58 Crossed wires

Mortal enemies

Colbie YoungWR · Cincinnati Bengals · ♌ Leo45 Stars at warDenzel BostonWR · Cleveland Browns · ♐ Sagittarius45 Stars at warRashod BatemanWR · Baltimore Ravens · ♐ Sagittarius51 Crossed wires

Daylen's chart, read out

Daylen Everette is a Taurus, born May 6, 2004. That makes him a Fixed Earth sign, Apr 20 - May 20. His chart reads Taurus sun, Scorpio moon, Capricorn mercury, Gemini mars. Daylen keeps score privately, files away every rep he lost, and collects on it later. Daylen builds the drive in sequence and rarely takes the shot before the setup is in place. Daylen wins with quickness and change of direction instead of raw force. Read together, that is the shape of a Taurus in the secondary for the Pittsburgh Steelers.

Daylen Everette: frequently asked

What is Daylen Everette's zodiac sign?

Daylen Everette is a Taurus, born May 6, 2004. Taurus runs Apr 20 - May 20 and is an Earth sign.

What is Daylen Everette's moon sign?

Daylen Everette has a Scorpio moon, calculated from his May 6, 2004 birthday. The moon describes how a player is wired when a play breaks down: Daylen keeps score privately, files away every rep he lost, and collects on it later.

What is Daylen Everette's mercury sign?

Daylen Everette has Capricorn mercury, the placement that describes how he processes the game. Daylen builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Daylen Everette's mars sign?

Daylen Everette has Gemini mars, which describes how the physical effort arrives. Daylen wins with quickness and change of direction instead of raw force.

How does being a Taurus show up in the secondary?

Taurus reads as: Immovable in the trenches; Grinds out the tough yards. For Daylen Everette in the secondary with the Pittsburgh Steelers, that is the baseline the rest of the chart adjusts. In his case mars is in Gemini: Daylen wins with quickness and change of direction instead of raw force.

NFL stats

Defense · 1 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
20265111010000000.0004000
Career5111010000000.0004000