27Malachi Moore
  • PositionSafety
  • Height5' 11"
  • Weight196 lbs
  • Age25
  • Experience2 yrs
  • CollegeAlabama
New York Jets · Safety

Malachi Moore

♍Virgo sun · Aug 23 - Sep 22EarthCosmic energy★★★★★

Malachi Moore is a Virgo, born September 13, 2001, with a Gemini moon and Capricorn mercury. Disciplined, low-penalty football and clean route running rule the week.

Sun♍VirgoMoon♊GeminiMercury♑CapricornMars♑Capricorn
Surgical with assignmentsSweats the film detailsDisciplined, low-penalty football and clean route running rule the week.Cosmic energy is just for fun.

Malachi's matchups

Scored against all four placements, not just the sun

Best teammates

Minkah FitzpatrickFS · New York Jets · ♏ Scorpio90 Cosmic alignmentDane BeltonSS · New York Jets · ♐ Sagittarius51 Tense aspectsJamien SherwoodMLB · New York Jets · ♑ Capricorn76 Workable chemistry

Teammate frustrations

Adonai MitchellWR · New York Jets · ♎ Libra45 Stars at warJoe TippmannRG · New York Jets · ♈ Aries45 Stars at warArmand MembouRT · New York Jets · ♈ Aries51 Crossed wires

Mortal enemies

Greg DulcichTE · Miami Dolphins · ♈ Aries45 Stars at warDalton KincaidTE · Buffalo Bills · ♎ Libra49 Crossed wiresHunter HenryTE · New England Patriots · ♐ Sagittarius58 Crossed wires

Malachi's chart, read out

Malachi Moore is a Virgo, born September 13, 2001. That makes him a Mutable Earth sign, Aug 23 - Sep 22. His chart reads Virgo sun, Gemini moon, Capricorn mercury, Capricorn mars. Malachi processes out loud and adjusts mid-rep, which reads as restlessness until the adjustment works. Malachi builds the drive in sequence and rarely takes the shot before the setup is in place. Malachi grinds and outlasts, wearing down an opponent across four quarters rather than one snap. Read together, that is the shape of a Virgo in the secondary for the New York Jets.

Malachi Moore: frequently asked

What is Malachi Moore's zodiac sign?

Malachi Moore is a Virgo, born September 13, 2001. Virgo runs Aug 23 - Sep 22 and is an Earth sign.

What is Malachi Moore's moon sign?

Malachi Moore has a Gemini moon, calculated from his September 13, 2001 birthday. The moon describes how a player is wired when a play breaks down: Malachi processes out loud and adjusts mid-rep, which reads as restlessness until the adjustment works.

What is Malachi Moore's mercury sign?

Malachi Moore has Capricorn mercury, the placement that describes how he processes the game. Malachi builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Malachi Moore's mars sign?

Malachi Moore has Capricorn mars, which describes how the physical effort arrives. Malachi grinds and outlasts, wearing down an opponent across four quarters rather than one snap.

How does being a Virgo show up in the secondary?

Virgo reads as: Surgical with assignments; Sweats the film details. For Malachi Moore in the secondary with the New York Jets, that is the baseline the rest of the chart adjusts. In his case mars is in Capricorn: Malachi grinds and outlasts, wearing down an opponent across four quarters rather than one snap.

NFL stats

Defense · 2 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
202517101564501125000.0003360
202655410000000.0000000
Career22106604601125000.0003360