49Trevin Wallace
  • PositionLinebacker
  • Height6' 1"
  • Weight244 lbs
  • Age23
  • Experience3 yrs
  • CollegeKentucky
New York Jets · Linebacker

Trevin Wallace

♓Pisces sun · Feb 19 - Mar 20WaterCosmic energy★★★★★

Trevin Wallace is a Pisces, born February 22, 2003, with a Libra moon and Capricorn mercury. Intuition over structure: improvised magic when the play breaks down.

Sun♓PiscesMoon♎LibraMercury♑CapricornMars♎Libra
Feels the flow of the gameInstinctive playmakerIntuition over structure: improvised magic when the play breaks down.Cosmic energy is just for fun.

Trevin's matchups

Scored against all four placements, not just the sun

Best teammates

Minkah FitzpatrickFS · New York Jets · ♏ Scorpio87 Strong synergyDane BeltonSS · New York Jets · ♐ Sagittarius56 Tense aspectsJamien SherwoodMLB · New York Jets · ♑ Capricorn68 Workable chemistry

Teammate frustrations

Armand MembouRT · New York Jets · ♈ Aries45 Stars at warJoe TippmannRG · New York Jets · ♈ Aries49 Crossed wiresAdonai MitchellWR · New York Jets · ♎ Libra51 Crossed wires

Mortal enemies

Dalton KincaidTE · Buffalo Bills · ♎ Libra45 Stars at warGreg DulcichTE · Miami Dolphins · ♈ Aries51 Crossed wiresJames Cook IIIRB · Buffalo Bills · ♎ Libra51 Crossed wires

Trevin's chart, read out

Trevin Wallace is a Pisces, born February 22, 2003. That makes him a Mutable Water sign, Feb 19 - Mar 20. His chart reads Pisces sun, Libra moon, Capricorn mercury, Libra mars. Trevin steadies a sideline that is fraying and rarely lets a bad series become a bad quarter. Trevin builds the drive in sequence and rarely takes the shot before the setup is in place. Trevin plays under control and balanced, rarely beaten by his own momentum. Read together, that is the shape of a Pisces at linebacker for the New York Jets.

Trevin Wallace: frequently asked

What is Trevin Wallace's zodiac sign?

Trevin Wallace is a Pisces, born February 22, 2003. Pisces runs Feb 19 - Mar 20 and is a Water sign.

What is Trevin Wallace's moon sign?

Trevin Wallace has a Libra moon, calculated from his February 22, 2003 birthday. The moon describes how a player is wired when a play breaks down: Trevin steadies a sideline that is fraying and rarely lets a bad series become a bad quarter.

What is Trevin Wallace's mercury sign?

Trevin Wallace has Capricorn mercury, the placement that describes how he processes the game. Trevin builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Trevin Wallace's mars sign?

Trevin Wallace has Libra mars, which describes how the physical effort arrives. Trevin plays under control and balanced, rarely beaten by his own momentum.

How does being a Pisces show up at linebacker?

Pisces reads as: Feels the flow of the game; Instinctive playmaker. For Trevin Wallace at linebacker with the New York Jets, that is the baseline the rest of the chart adjusts. In his case mars is in Libra: Trevin plays under control and balanced, rarely beaten by his own momentum.

NFL stats

Defense · 3 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
2024136436281210000.0000310
2025126136252000000.00043130
202632020010000.0000000
Career2812772553220000.00046140