27Tyler Nubin
  • PositionSafety
  • Height6' 2"
  • Weight210 lbs
  • Age25
  • Experience3 yrs
  • CollegeMinnesota
New York Giants · Safety

Tyler Nubin

♊Gemini sun · May 21 - Jun 20AirCosmic energy★★★★★

Tyler Nubin is a Gemini, born June 14, 2001, with a Pisces moon and Capricorn mercury. Look for trick plays, motion, and a playbook that keeps defenses guessing.

Sun♊GeminiMoon♓PiscesMercury♑CapricornMars♐Sagittarius
Reads two routes at onceQuick to improviseLook for trick plays, motion, and a playbook that keeps defenses guessing.Cosmic energy is just for fun.

Tyler's matchups

Scored against all four placements, not just the sun

Best teammates

Jevon HollandFS · New York Giants · ♓ Pisces69 Workable chemistryDJ ReaderNT · New York Giants · ♋ Cancer54 Tense aspectsIsaiah LikelyTE · New York Giants · ♈ Aries91 Cosmic alignment

Teammate frustrations

Malachi FieldsWR · New York Giants · ♍ Virgo51 Crossed wiresDarnell MooneyWR · New York Giants · ♏ Scorpio56 Crossed wiresBryan HudsonC · New York Giants · ♑ Capricorn58 Crossed wires

Mortal enemies

Antonio WilliamsWR · Washington Commanders · ♋ Cancer56 Crossed wiresChig OkonkwoTE · Washington Commanders · ♍ Virgo56 Crossed wiresDallas GoedertTE · Philadelphia Eagles · ♑ Capricorn56 Crossed wires

Tyler's chart, read out

Tyler Nubin is a Gemini, born June 14, 2001. That makes him a Mutable Air sign, May 21 - Jun 20. His chart reads Gemini sun, Pisces moon, Capricorn mercury, Sagittarius mars. Tyler feels the flow of a game before the numbers show it, and plays the version of the down that is actually happening. Tyler builds the drive in sequence and rarely takes the shot before the setup is in place. Tyler plays with range, covering ground others need an extra step to reach. Read together, that is the shape of a Gemini in the secondary for the New York Giants.

Tyler Nubin: frequently asked

What is Tyler Nubin's zodiac sign?

Tyler Nubin is a Gemini, born June 14, 2001. Gemini runs May 21 - Jun 20 and is an Air sign.

What is Tyler Nubin's moon sign?

Tyler Nubin has a Pisces moon, calculated from his June 14, 2001 birthday. The moon describes how a player is wired when a play breaks down: Tyler feels the flow of a game before the numbers show it, and plays the version of the down that is actually happening.

What is Tyler Nubin's mercury sign?

Tyler Nubin has Capricorn mercury, the placement that describes how he processes the game. Tyler builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Tyler Nubin's mars sign?

Tyler Nubin has Sagittarius mars, which describes how the physical effort arrives. Tyler plays with range, covering ground others need an extra step to reach.

How does being a Gemini show up in the secondary?

Gemini reads as: Reads two routes at once; Quick to improvise. For Tyler Nubin in the secondary with the New York Giants, that is the baseline the rest of the chart adjusts. In his case mars is in Sagittarius: Tyler plays with range, covering ground others need an extra step to reach.

NFL stats

Defense · 3 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
2024139857410112000.00014.560
20251378492900127000.00028190
20264191450000000.0003000
Career301951207501229000.000612.5250