76Jon Runyan
  • PositionGuard
  • Height6' 4"
  • Weight307 lbs
  • Age29
  • Experience7 yrs
  • CollegeMichigan
New York Giants · Guard

Jon Runyan

♌Leo sun · Jul 23 - Aug 22FireCosmic energy★★★★★

Jon Runyan is a Leo, born August 8, 1997, with a Virgo moon and Capricorn mercury. Stars want the spotlight this week. Expect highlight-reel swagger.

Sun♌LeoMoon♍VirgoMercury♑CapricornMars♏Scorpio
Born for prime timeThrives under the lightsStars want the spotlight this week. Expect highlight-reel swagger.Cosmic energy is just for fun.

Jon's matchups

Scored against all four placements, not just the sun

Best teammates

Andrew ThomasLT · New York Giants · ♒ Aquarius79 Workable chemistryBryan HudsonC · New York Giants · ♑ Capricorn62 Workable chemistryCam SkatteboRB · New York Giants · ♒ Aquarius74 Workable chemistry

Teammate frustrations

Jameis WinstonQB · New York Giants · ♑ Capricorn54 Crossed wiresMalachi FieldsWR · New York Giants · ♍ Virgo45 Stars at warDarnell MooneyWR · New York Giants · ♏ Scorpio59 Crossed wires

Mortal enemies

Otito OgbonniaNT · Dallas Cowboys · ♍ Virgo58 Crossed wiresDaron PayneNT · Washington Commanders · ♊ Gemini86 Surprisingly civilJeremy ReavesFS · Washington Commanders · ♍ Virgo51 Crossed wires

Jon's chart, read out

Jon Runyan is a Leo, born August 8, 1997. That makes him a Fixed Fire sign, Jul 23 - Aug 22. His chart reads Leo sun, Virgo moon, Capricorn mercury, Scorpio mars. Jon replays the one bad rep long after the film session ends, which is both the flaw and the engine. Jon builds the drive in sequence and rarely takes the shot before the setup is in place. Jon finishes every rep through the whistle and plays with a grudge. Read together, that is the shape of a Leo in the trenches for the New York Giants.

Jon Runyan: frequently asked

What is Jon Runyan's zodiac sign?

Jon Runyan is a Leo, born August 8, 1997. Leo runs Jul 23 - Aug 22 and is a Fire sign.

What is Jon Runyan's moon sign?

Jon Runyan has a Virgo moon, calculated from his August 8, 1997 birthday. The moon describes how a player is wired when a play breaks down: Jon replays the one bad rep long after the film session ends, which is both the flaw and the engine.

What is Jon Runyan's mercury sign?

Jon Runyan has Capricorn mercury, the placement that describes how he processes the game. Jon builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Jon Runyan's mars sign?

Jon Runyan has Scorpio mars, which describes how the physical effort arrives. Jon finishes every rep through the whistle and plays with a grudge.

How does being a Leo show up in the trenches?

Leo reads as: Born for prime time; Thrives under the lights. For Jon Runyan in the trenches with the New York Giants, that is the baseline the rest of the chart adjusts. In his case mars is in Scorpio: Jon finishes every rep through the whistle and plays with a grudge.

NFL stats

Defense · 2 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
2023171100000000.0000000
202650000010000.0000000
Career221100010000.0000000