52Christen Miller
  • PositionDefensive Tackle
  • Height6' 3"
  • Weight321 lbs
  • Age22
  • ExperienceRookie
  • CollegeGeorgia
New Orleans Saints · Defensive Tackle

Christen Miller

♌Leo sun · Jul 23 - Aug 22FireCosmic energy★★★★★

Christen Miller is a Leo, born August 5, 2004, with a Pisces moon and Capricorn mercury. Stars want the spotlight this week. Expect highlight-reel swagger.

Sun♌LeoMoon♓PiscesMercury♑CapricornMars♌Leo
Born for prime timeThrives under the lightsStars want the spotlight this week. Expect highlight-reel swagger.Cosmic energy is just for fun.

Christen's matchups

Scored against all four placements, not just the sun

Best teammates

Nathan ShepherdNT · New Orleans Saints · ♎ Libra68 Workable chemistryJustin ReidSS · New Orleans Saints · ♒ Aquarius88 Strong synergyJulian BlackmonFS · New Orleans Saints · ♍ Virgo68 Workable chemistry

Teammate frustrations

David EdwardsLG · New Orleans Saints · ♓ Pisces45 Stars at warChris OlaveWR · New Orleans Saints · ♋ Cancer55 Crossed wiresErik McCoyC · New Orleans Saints · ♍ Virgo56 Crossed wires

Mortal enemies

Matthew BergeronLG · Atlanta Falcons · ♓ Pisces45 Stars at warRobert HuntRG · Carolina Panthers · ♍ Virgo45 Stars at warChris LindstromRG · Atlanta Falcons · ♓ Pisces55 Crossed wires

Christen's chart, read out

Christen Miller is a Leo, born August 5, 2004. That makes him a Fixed Fire sign, Jul 23 - Aug 22. His chart reads Leo sun, Pisces moon, Capricorn mercury, Leo mars. Christen feels the flow of a game before the numbers show it, and plays the version of the down that is actually happening. Christen builds the drive in sequence and rarely takes the shot before the setup is in place. Christen saves the biggest effort for the biggest snap, which makes the highlights and the tape disagree. Read together, that is the shape of a Leo in the trenches for the New Orleans Saints.

Christen Miller: frequently asked

What is Christen Miller's zodiac sign?

Christen Miller is a Leo, born August 5, 2004. Leo runs Jul 23 - Aug 22 and is a Fire sign.

What is Christen Miller's moon sign?

Christen Miller has a Pisces moon, calculated from his August 5, 2004 birthday. The moon describes how a player is wired when a play breaks down: Christen feels the flow of a game before the numbers show it, and plays the version of the down that is actually happening.

What is Christen Miller's mercury sign?

Christen Miller has Capricorn mercury, the placement that describes how he processes the game. Christen builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Christen Miller's mars sign?

Christen Miller has Leo mars, which describes how the physical effort arrives. Christen saves the biggest effort for the biggest snap, which makes the highlights and the tape disagree.

How does being a Leo show up in the trenches?

Leo reads as: Born for prime time; Thrives under the lights. For Christen Miller in the trenches with the New Orleans Saints, that is the baseline the rest of the chart adjusts. In his case mars is in Leo: Christen saves the biggest effort for the biggest snap, which makes the highlights and the tape disagree.

NFL stats

Defense · 1 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
202621100000000.0000000
Career21100000000.0000000