38Jayden Price
  • PositionCornerback
  • Height5' 11"
  • Weight185 lbs
  • Age26
  • Experience1 yrs
  • CollegeNorth Dakota State
New Orleans Saints · Cornerback

Jayden Price

♈Aries sun · Mar 21 - Apr 19FireCosmic energy★★★★★

Jayden Price is a Aries, born April 5, 2000, with a Pisces moon and Capricorn mercury. Expect early aggression and a hot start before the whistle even settles.

Sun♈AriesMoon♓PiscesMercury♑CapricornMars♈Aries
First off the ballFearless, sometimes recklessExpect early aggression and a hot start before the whistle even settles.Cosmic energy is just for fun.

Jayden's matchups

Scored against all four placements, not just the sun

Best teammates

Justin ReidSS · New Orleans Saints · ♒ Aquarius89 Strong synergyJulian BlackmonFS · New Orleans Saints · ♍ Virgo68 Workable chemistryNathan ShepherdNT · New Orleans Saints · ♎ Libra68 Workable chemistry

Teammate frustrations

David EdwardsLG · New Orleans Saints · ♓ Pisces45 Stars at warChris OlaveWR · New Orleans Saints · ♋ Cancer55 Crossed wiresErik McCoyC · New Orleans Saints · ♍ Virgo56 Crossed wires

Mortal enemies

Ted Hurst IIIWR · Tampa Bay Buccaneers · ♋ Cancer51 Crossed wiresJalen CokerWR · Carolina Panthers · ♏ Scorpio59 Crossed wiresBrycen TremayneWR · Carolina Panthers · ♏ Scorpio65 Uneasy orbit

Jayden's chart, read out

Jayden Price is an Aries, born April 5, 2000. That makes him a Cardinal Fire sign, Mar 21 - Apr 19. His chart reads Aries sun, Pisces moon, Capricorn mercury, Aries mars. Jayden feels the flow of a game before the numbers show it, and plays the version of the down that is actually happening. Jayden builds the drive in sequence and rarely takes the shot before the setup is in place. Jayden attacks downhill with no wind-up, first off the ball more often than not. Read together, that is the shape of an Aries in the secondary for the New Orleans Saints.

Jayden Price: frequently asked

What is Jayden Price's zodiac sign?

Jayden Price is an Aries, born April 5, 2000. Aries runs Mar 21 - Apr 19 and is a Fire sign.

What is Jayden Price's moon sign?

Jayden Price has a Pisces moon, calculated from his April 5, 2000 birthday. The moon describes how a player is wired when a play breaks down: Jayden feels the flow of a game before the numbers show it, and plays the version of the down that is actually happening.

What is Jayden Price's mercury sign?

Jayden Price has Capricorn mercury, the placement that describes how he processes the game. Jayden builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Jayden Price's mars sign?

Jayden Price has Aries mars, which describes how the physical effort arrives. Jayden attacks downhill with no wind-up, first off the ball more often than not.

How does being an Aries show up in the secondary?

Aries reads as: First off the ball; Fearless, sometimes reckless. For Jayden Price in the secondary with the New Orleans Saints, that is the baseline the rest of the chart adjusts. In his case mars is in Aries: Jayden attacks downhill with no wind-up, first off the ball more often than not.

NFL stats

Defense · 1 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
202653120000000.0000000
Career53120000000.0000000