65Matt Pryor
  • PositionOffensive Tackle
  • Height6' 7"
  • Weight332 lbs
  • Age31
  • Experience9 yrs
  • CollegeTCU
New England Patriots · Offensive Tackle

Matt Pryor

♐Sagittarius sun · Nov 22 - Dec 21FireCosmic energy★★★★★

Matt Pryor is a Sagittarius, born December 16, 1994, with a Taurus moon and Capricorn mercury. Shots downfield abound. Expect explosive, vertical offense.

Sun♐SagittariusMoon♉TaurusMercury♑CapricornMars♊Gemini
Lives for the deep ballBig-play hunterShots downfield abound. Expect explosive, vertical offense.Cosmic energy is just for fun.

Matt's matchups

Scored against all four placements, not just the sun

Best teammates

Jared WilsonC · New England Patriots · ♊ Gemini90 Cosmic alignmentAlijah Vera-TuckerLG · New England Patriots · ♊ Gemini68 Workable chemistryWill CampbellLT · New England Patriots · ♑ Capricorn66 Workable chemistry

Teammate frustrations

Ben BrownRG · New England Patriots · ♉ Taurus51 Crossed wiresMorgan MosesRT · New England Patriots · ♓ Pisces62 Uneasy orbitRhamondre StevensonRB · New England Patriots · ♓ Pisces45 Stars at war

Mortal enemies

Deone WalkerNT · Buffalo Bills · ♓ Pisces51 Crossed wiresJacob RodriguezMLB · Miami Dolphins · ♍ Virgo51 Crossed wiresJamien SherwoodMLB · New York Jets · ♑ Capricorn56 Crossed wires

Matt's chart, read out

Matt Pryor is a Sagittarius, born December 16, 1994. That makes him a Mutable Fire sign, Nov 22 - Dec 21. His chart reads Sagittarius sun, Taurus moon, Capricorn mercury, Gemini mars. Matt settles rather than spikes under pressure, holding the same tempo in the fourth quarter as the first. Matt builds the drive in sequence and rarely takes the shot before the setup is in place. Matt wins with quickness and change of direction instead of raw force. Read together, that is the shape of a Sagittarius in the trenches for the New England Patriots.

Matt Pryor: frequently asked

What is Matt Pryor's zodiac sign?

Matt Pryor is a Sagittarius, born December 16, 1994. Sagittarius runs Nov 22 - Dec 21 and is a Fire sign.

What is Matt Pryor's moon sign?

Matt Pryor has a Taurus moon, calculated from his December 16, 1994 birthday. The moon describes how a player is wired when a play breaks down: Matt settles rather than spikes under pressure, holding the same tempo in the fourth quarter as the first.

What is Matt Pryor's mercury sign?

Matt Pryor has Capricorn mercury, the placement that describes how he processes the game. Matt builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Matt Pryor's mars sign?

Matt Pryor has Gemini mars, which describes how the physical effort arrives. Matt wins with quickness and change of direction instead of raw force.

How does being a Sagittarius show up in the trenches?

Sagittarius reads as: Lives for the deep ball; Big-play hunter. For Matt Pryor in the trenches with the New England Patriots, that is the baseline the rest of the chart adjusts. In his case mars is in Gemini: Matt wins with quickness and change of direction instead of raw force.

NFL stats

Defense · 1 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
2024170000010000.0000000
Career100000010000.0000000