16Michael Taaffe
  • PositionSafety
  • Height6' 0"
  • Weight190 lbs
  • Age23
  • ExperienceRookie
  • CollegeTexas
Miami Dolphins · Safety

Michael Taaffe

♒Aquarius sun · Jan 20 - Feb 18AirCosmic energy★★★★★

Michael Taaffe is a Aquarius, born February 18, 2003, with a Leo moon and Capricorn mercury. Unconventional looks and creative play-calling steal the show.

Sun♒AquariusMoon♌LeoMercury♑CapricornMars♎Libra
Innovates the schemeSees the field differentlyUnconventional looks and creative play-calling steal the show.Cosmic energy is just for fun.

Michael's matchups

Scored against all four placements, not just the sun

Best teammates

Dante Trader Jr.SS · Miami Dolphins · ♒ Aquarius78 Workable chemistryZayne AndersonFS · Miami Dolphins · ♑ Capricorn51 Tense aspectsJacob RodriguezMLB · Miami Dolphins · ♍ Virgo59 Tense aspects

Teammate frustrations

Aaron BrewerC · Miami Dolphins · ♏ Scorpio45 Stars at warMalik WashingtonWR · Miami Dolphins · ♑ Capricorn51 Crossed wiresOllie Gordon IIRB · Miami Dolphins · ♑ Capricorn51 Crossed wires

Mortal enemies

Kenyon SadiqTE · New York Jets · ♓ Pisces45 Stars at warGarrett WilsonWR · New York Jets · ♋ Cancer51 Crossed wiresKeon ColemanWR · Buffalo Bills · ♉ Taurus55 Crossed wires

Michael's chart, read out

Michael Taaffe is an Aquarius, born February 18, 2003. That makes him a Fixed Air sign, Jan 20 - Feb 18. His chart reads Aquarius sun, Leo moon, Capricorn mercury, Libra mars. Michael needs the moment to matter, and finds another gear once the cameras find him. Michael builds the drive in sequence and rarely takes the shot before the setup is in place. Michael plays under control and balanced, rarely beaten by his own momentum. Read together, that is the shape of an Aquarius in the secondary for the Miami Dolphins.

Michael Taaffe: frequently asked

What is Michael Taaffe's zodiac sign?

Michael Taaffe is an Aquarius, born February 18, 2003. Aquarius runs Jan 20 - Feb 18 and is an Air sign.

What is Michael Taaffe's moon sign?

Michael Taaffe has a Leo moon, calculated from his February 18, 2003 birthday. The moon describes how a player is wired when a play breaks down: Michael needs the moment to matter, and finds another gear once the cameras find him.

What is Michael Taaffe's mercury sign?

Michael Taaffe has Capricorn mercury, the placement that describes how he processes the game. Michael builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Michael Taaffe's mars sign?

Michael Taaffe has Libra mars, which describes how the physical effort arrives. Michael plays under control and balanced, rarely beaten by his own momentum.

How does being an Aquarius show up in the secondary?

Aquarius reads as: Innovates the scheme; Sees the field differently. For Michael Taaffe in the secondary with the Miami Dolphins, that is the baseline the rest of the chart adjusts. In his case mars is in Libra: Michael plays under control and balanced, rarely beaten by his own momentum.

NFL stats

Defense · 1 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
202653014160100122.00210.500
Career53014160100122.00210.500