Mazi Smith
  • PositionDefensive Tackle
  • Height6' 3"
  • Weight337 lbs
  • Age25
  • Experience5 yrs
  • CollegeMichigan
Miami Dolphins · Defensive Tackle

Mazi Smith

♊Gemini sun · May 21 - Jun 20AirCosmic energy★★★★★

Mazi Smith is a Gemini, born June 16, 2001, with a Pisces moon and Capricorn mercury. Look for trick plays, motion, and a playbook that keeps defenses guessing.

Sun♊GeminiMoon♓PiscesMercury♑CapricornMars♐Sagittarius
Reads two routes at onceQuick to improviseLook for trick plays, motion, and a playbook that keeps defenses guessing.Cosmic energy is just for fun.

Mazi's chart, read out

Mazi Smith is a Gemini, born June 16, 2001. That makes him a Mutable Air sign, May 21 - Jun 20. His chart reads Gemini sun, Pisces moon, Capricorn mercury, Sagittarius mars. Mazi feels the flow of a game before the numbers show it, and plays the version of the down that is actually happening. Mazi builds the drive in sequence and rarely takes the shot before the setup is in place. Mazi plays with range, covering ground others need an extra step to reach. Read together, that is the shape of a Gemini in the trenches for the Miami Dolphins.

Mazi Smith: frequently asked

What is Mazi Smith's zodiac sign?

Mazi Smith is a Gemini, born June 16, 2001. Gemini runs May 21 - Jun 20 and is an Air sign.

What is Mazi Smith's moon sign?

Mazi Smith has a Pisces moon, calculated from his June 16, 2001 birthday. The moon describes how a player is wired when a play breaks down: Mazi feels the flow of a game before the numbers show it, and plays the version of the down that is actually happening.

What is Mazi Smith's mercury sign?

Mazi Smith has Capricorn mercury, the placement that describes how he processes the game. Mazi builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Mazi Smith's mars sign?

Mazi Smith has Sagittarius mars, which describes how the physical effort arrives. Mazi plays with range, covering ground others need an extra step to reach.

How does being a Gemini show up in the trenches?

Gemini reads as: Reads two routes at once; Quick to improvise. For Mazi Smith in the trenches with the Miami Dolphins, that is the baseline the rest of the chart adjusts. In his case mars is in Sagittarius: Mazi plays with range, covering ground others need an extra step to reach.

NFL stats

Defense · 3 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
20231713941000000.0000130
2024174122191000000.00005.560
202553030000000.0000000
Career395731262000000.00006.590