56Shaun Dolac
  • PositionLinebacker
  • Height6' 1"
  • Weight222 lbs
  • Age25
  • Experience2 yrs
  • CollegeBuffalo
Los Angeles Rams · Linebacker

Shaun Dolac

♍Virgo sun · Aug 23 - Sep 22EarthCosmic energy★★★★★

Shaun Dolac is a Virgo, born September 14, 2001, with a Cancer moon and Capricorn mercury. Disciplined, low-penalty football and clean route running rule the week.

Sun♍VirgoMoon♋CancerMercury♑CapricornMars♑Capricorn
Surgical with assignmentsSweats the film detailsDisciplined, low-penalty football and clean route running rule the week.Cosmic energy is just for fun.

Shaun's matchups

Scored against all four placements, not just the sun

Best teammates

Poona FordNT · Los Angeles Rams · ♏ Scorpio84 Strong synergyKamren KinchensFS · Los Angeles Rams · ♎ Libra63 Workable chemistryKam CurlSS · Los Angeles Rams · ♈ Aries62 Workable chemistry

Teammate frustrations

Steve AvilaLG · Los Angeles Rams · ♎ Libra49 Crossed wiresJordan WhittingtonWR · Los Angeles Rams · ♎ Libra51 Crossed wiresColeman SheltonC · Los Angeles Rams · ♌ Leo54 Crossed wires

Mortal enemies

Christian McCaffreyRB · San Francisco 49ers · ♊ Gemini51 Crossed wiresGeorge KittleTE · San Francisco 49ers · ♎ Libra51 Crossed wiresTrey McBrideTE · Arizona Cardinals · ♐ Sagittarius51 Crossed wires

Shaun's chart, read out

Shaun Dolac is a Virgo, born September 14, 2001. That makes him a Mutable Earth sign, Aug 23 - Sep 22. His chart reads Virgo sun, Cancer moon, Capricorn mercury, Capricorn mars. Shaun plays off the emotional temperature of the huddle and lifts noticeably in front of a home crowd. Shaun builds the drive in sequence and rarely takes the shot before the setup is in place. Shaun grinds and outlasts, wearing down an opponent across four quarters rather than one snap. Read together, that is the shape of a Virgo at linebacker for the Los Angeles Rams.

Shaun Dolac: frequently asked

What is Shaun Dolac's zodiac sign?

Shaun Dolac is a Virgo, born September 14, 2001. Virgo runs Aug 23 - Sep 22 and is an Earth sign.

What is Shaun Dolac's moon sign?

Shaun Dolac has a Cancer moon, calculated from his September 14, 2001 birthday. The moon describes how a player is wired when a play breaks down: Shaun plays off the emotional temperature of the huddle and lifts noticeably in front of a home crowd.

What is Shaun Dolac's mercury sign?

Shaun Dolac has Capricorn mercury, the placement that describes how he processes the game. Shaun builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Shaun Dolac's mars sign?

Shaun Dolac has Capricorn mars, which describes how the physical effort arrives. Shaun grinds and outlasts, wearing down an opponent across four quarters rather than one snap.

How does being a Virgo show up at linebacker?

Virgo reads as: Surgical with assignments; Sweats the film details. For Shaun Dolac at linebacker with the Los Angeles Rams, that is the baseline the rest of the chart adjusts. In his case mars is in Capricorn: Shaun grinds and outlasts, wearing down an opponent across four quarters rather than one snap.

NFL stats

Defense · 2 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
202517251690000000.00002.520
2026512660000000.0000000
Career223722150000000.00002.520