58Elias Neal
  • PositionLinebacker
  • Height6' 0"
  • Weight221 lbs
  • Age25
  • Experience2 yrs
  • CollegeMarshall
Los Angeles Rams · Linebacker

Elias Neal

♍Virgo sun · Aug 23 - Sep 22EarthCosmic energy★★★★★

Elias Neal is a Virgo, born September 11, 2001, with a Taurus moon and Capricorn mercury. Disciplined, low-penalty football and clean route running rule the week.

Sun♍VirgoMoon♉TaurusMercury♑CapricornMars♑Capricorn
Surgical with assignmentsSweats the film detailsDisciplined, low-penalty football and clean route running rule the week.Cosmic energy is just for fun.

Elias's matchups

Scored against all four placements, not just the sun

Best teammates

Poona FordNT · Los Angeles Rams · ♏ Scorpio86 Strong synergyKam CurlSS · Los Angeles Rams · ♈ Aries63 Workable chemistryKamren KinchensFS · Los Angeles Rams · ♎ Libra60 Workable chemistry

Teammate frustrations

Steve AvilaLG · Los Angeles Rams · ♎ Libra49 Crossed wiresJordan WhittingtonWR · Los Angeles Rams · ♎ Libra51 Crossed wiresColeman SheltonC · Los Angeles Rams · ♌ Leo56 Crossed wires

Mortal enemies

Christian McCaffreyRB · San Francisco 49ers · ♊ Gemini51 Crossed wiresGeorge KittleTE · San Francisco 49ers · ♎ Libra51 Crossed wiresTrey McBrideTE · Arizona Cardinals · ♐ Sagittarius51 Crossed wires

Elias's chart, read out

Elias Neal is a Virgo, born September 11, 2001. That makes him a Mutable Earth sign, Aug 23 - Sep 22. His chart reads Virgo sun, Taurus moon, Capricorn mercury, Capricorn mars. Elias settles rather than spikes under pressure, holding the same tempo in the fourth quarter as the first. Elias builds the drive in sequence and rarely takes the shot before the setup is in place. Elias grinds and outlasts, wearing down an opponent across four quarters rather than one snap. Read together, that is the shape of a Virgo at linebacker for the Los Angeles Rams.

Elias Neal: frequently asked

What is Elias Neal's zodiac sign?

Elias Neal is a Virgo, born September 11, 2001. Virgo runs Aug 23 - Sep 22 and is an Earth sign.

What is Elias Neal's moon sign?

Elias Neal has a Taurus moon, calculated from his September 11, 2001 birthday. The moon describes how a player is wired when a play breaks down: Elias settles rather than spikes under pressure, holding the same tempo in the fourth quarter as the first.

What is Elias Neal's mercury sign?

Elias Neal has Capricorn mercury, the placement that describes how he processes the game. Elias builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Elias Neal's mars sign?

Elias Neal has Capricorn mars, which describes how the physical effort arrives. Elias grinds and outlasts, wearing down an opponent across four quarters rather than one snap.

How does being a Virgo show up at linebacker?

Virgo reads as: Surgical with assignments; Sweats the film details. For Elias Neal at linebacker with the Los Angeles Rams, that is the baseline the rest of the chart adjusts. In his case mars is in Capricorn: Elias grinds and outlasts, wearing down an opponent across four quarters rather than one snap.

NFL stats

Defense · 1 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
202523210000000.0000000
Career23210000000.0000000