31Treydan Stukes
  • PositionSafety
  • Height6' 2"
  • Weight200 lbs
  • Age25
  • ExperienceRookie
  • CollegeArizona
Las Vegas Raiders · Safety

Treydan Stukes

♍Virgo sun · Aug 23 - Sep 22EarthCosmic energy★★★★★

Treydan Stukes is a Virgo, born September 11, 2001, with a Taurus moon and Capricorn mercury. Disciplined, low-penalty football and clean route running rule the week.

Sun♍VirgoMoon♉TaurusMercury♑CapricornMars♑Capricorn
Surgical with assignmentsSweats the film detailsDisciplined, low-penalty football and clean route running rule the week.Cosmic energy is just for fun.

Treydan's matchups

Scored against all four placements, not just the sun

Best teammates

Jeremy ChinnSS · Las Vegas Raiders · ♓ Pisces79 Workable chemistryAdam ButlerNT · Las Vegas Raiders · ♈ Aries51 Tense aspectsKolton MillerLT · Las Vegas Raiders · ♍ Virgo84 Strong synergy

Teammate frustrations

Tyler LinderbaumC · Las Vegas Raiders · ♈ Aries54 Crossed wiresCaleb RogersRG · Las Vegas Raiders · ♎ Libra56 Crossed wiresConnor HeywardFB · Las Vegas Raiders · ♒ Aquarius56 Crossed wires

Mortal enemies

Jalen RoyalsWR · Kansas City Chiefs · ♒ Aquarius49 Crossed wiresCourtland SuttonWR · Denver Broncos · ♎ Libra51 Crossed wiresJaylen WaddleWR · Denver Broncos · ♐ Sagittarius51 Crossed wires

Treydan's chart, read out

Treydan Stukes is a Virgo, born September 11, 2001. That makes him a Mutable Earth sign, Aug 23 - Sep 22. His chart reads Virgo sun, Taurus moon, Capricorn mercury, Capricorn mars. Treydan settles rather than spikes under pressure, holding the same tempo in the fourth quarter as the first. Treydan builds the drive in sequence and rarely takes the shot before the setup is in place. Treydan grinds and outlasts, wearing down an opponent across four quarters rather than one snap. Read together, that is the shape of a Virgo in the secondary for the Las Vegas Raiders.

Treydan Stukes: frequently asked

What is Treydan Stukes's zodiac sign?

Treydan Stukes is a Virgo, born September 11, 2001. Virgo runs Aug 23 - Sep 22 and is an Earth sign.

What is Treydan Stukes's moon sign?

Treydan Stukes has a Taurus moon, calculated from his September 11, 2001 birthday. The moon describes how a player is wired when a play breaks down: Treydan settles rather than spikes under pressure, holding the same tempo in the fourth quarter as the first.

What is Treydan Stukes's mercury sign?

Treydan Stukes has Capricorn mercury, the placement that describes how he processes the game. Treydan builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Treydan Stukes's mars sign?

Treydan Stukes has Capricorn mars, which describes how the physical effort arrives. Treydan grinds and outlasts, wearing down an opponent across four quarters rather than one snap.

How does being a Virgo show up in the secondary?

Virgo reads as: Surgical with assignments; Sweats the film details. For Treydan Stukes in the secondary with the Las Vegas Raiders, that is the baseline the rest of the chart adjusts. In his case mars is in Capricorn: Treydan grinds and outlasts, wearing down an opponent across four quarters rather than one snap.

NFL stats

Defense · 1 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
20264171160000100.0001000
Career4171160000100.0001000