96Marcus Harris
  • PositionDefensive Tackle
  • Height6' 3"
  • Weight295 lbs
  • Age26
  • Experience1 yrs
  • CollegeAuburn
Kansas City Chiefs · Defensive Tackle

Marcus Harris

♎Libra sun · Sep 23 - Oct 23AirCosmic energy★★★★★

Marcus Harris is a Libra, born September 27, 2000, with a Virgo moon and Capricorn mercury. A week for poise: even matchups decided in the final possession.

Sun♎LibraMoon♍VirgoMercury♑CapricornMars♋Cancer
Balances both sides of the ballCalm in the chaosA week for poise: even matchups decided in the final possession.Cosmic energy is just for fun.

Marcus's matchups

Scored against all four placements, not just the sun

Best teammates

Nick BoltonMLB · Kansas City Chiefs · ♓ Pisces45 Tense aspectsAlohi GilmanFS · Kansas City Chiefs · ♍ Virgo56 Tense aspectsChamarri ConnerSS · Kansas City Chiefs · ♋ Cancer51 Tense aspects

Teammate frustrations

Kingsley SuamataiaLG · Kansas City Chiefs · ♑ Capricorn45 Stars at warRashee RiceWR · Kansas City Chiefs · ♉ Taurus56 Crossed wiresXavier WorthyWR · Kansas City Chiefs · ♉ Taurus56 Crossed wires

Mortal enemies

Spencer BurfordLG · Las Vegas Raiders · ♋ Cancer45 Stars at warKayode AwosikaLG · Los Angeles Chargers · ♏ Scorpio49 Crossed wiresLuke WattenbergC · Denver Broncos · ♍ Virgo56 Crossed wires

Marcus's chart, read out

Marcus Harris is a Libra, born September 27, 2000. That makes him a Cardinal Air sign, Sep 23 - Oct 23. His chart reads Libra sun, Virgo moon, Capricorn mercury, Cancer mars. Marcus replays the one bad rep long after the film session ends, which is both the flaw and the engine. Marcus builds the drive in sequence and rarely takes the shot before the setup is in place. Marcus plays hardest when protecting someone, whether that is a quarterback or a lead. Read together, that is the shape of a Libra in the trenches for the Kansas City Chiefs.

Marcus Harris: frequently asked

What is Marcus Harris's zodiac sign?

Marcus Harris is a Libra, born September 27, 2000. Libra runs Sep 23 - Oct 23 and is an Air sign.

What is Marcus Harris's moon sign?

Marcus Harris has a Virgo moon, calculated from his September 27, 2000 birthday. The moon describes how a player is wired when a play breaks down: Marcus replays the one bad rep long after the film session ends, which is both the flaw and the engine.

What is Marcus Harris's mercury sign?

Marcus Harris has Capricorn mercury, the placement that describes how he processes the game. Marcus builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Marcus Harris's mars sign?

Marcus Harris has Cancer mars, which describes how the physical effort arrives. Marcus plays hardest when protecting someone, whether that is a quarterback or a lead.

How does being a Libra show up in the trenches?

Libra reads as: Balances both sides of the ball; Calm in the chaos. For Marcus Harris in the trenches with the Kansas City Chiefs, that is the baseline the rest of the chart adjusts. In his case mars is in Cancer: Marcus plays hardest when protecting someone, whether that is a quarterback or a lead.

NFL stats

Defense · 1 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
202621010000000.0000000
Career21010000000.0000000