98Albert Regis
  • PositionDefensive Tackle
  • Height6' 1"
  • Weight295 lbs
  • Age23
  • ExperienceRookie
  • CollegeTexas A&M
Jacksonville Jaguars · Defensive Tackle

Albert Regis

♉Taurus sun · Apr 20 - May 20EarthCosmic energy★★★★★

Albert Regis is a Taurus, born May 17, 2003, with a Scorpio moon and Capricorn mercury. A week to lean on the run game and wear opponents down.

Sun♉TaurusMoon♏ScorpioMercury♑CapricornMars♐Sagittarius
Immovable in the trenchesGrinds out the tough yardsA week to lean on the run game and wear opponents down.Cosmic energy is just for fun.

Albert's matchups

Scored against all four placements, not just the sun

Best teammates

Ventrell MillerMLB · Jacksonville Jaguars · ♑ Capricorn89 Strong synergyAntonio JohnsonFS · Jacksonville Jaguars · ♏ Scorpio86 Strong synergyEric MurraySS · Jacksonville Jaguars · ♑ Capricorn74 Workable chemistry

Teammate frustrations

Trevor LawrenceQB · Jacksonville Jaguars · ♎ Libra49 Crossed wiresBhayshul TutenRB · Jacksonville Jaguars · ♒ Aquarius51 Crossed wiresParker WashingtonWR · Jacksonville Jaguars · ♈ Aries62 Uneasy orbit

Mortal enemies

Matt GoncalvesRG · Indianapolis Colts · ♒ Aquarius45 Stars at warEd IngramRG · Houston Texans · ♒ Aquarius54 Crossed wiresAtonio MafiRG · Tennessee Titans · ♎ Libra58 Crossed wires

Albert's chart, read out

Albert Regis is a Taurus, born May 17, 2003. That makes him a Fixed Earth sign, Apr 20 - May 20. His chart reads Taurus sun, Scorpio moon, Capricorn mercury, Sagittarius mars. Albert keeps score privately, files away every rep he lost, and collects on it later. Albert builds the drive in sequence and rarely takes the shot before the setup is in place. Albert plays with range, covering ground others need an extra step to reach. Read together, that is the shape of a Taurus in the trenches for the Jacksonville Jaguars.

Albert Regis: frequently asked

What is Albert Regis's zodiac sign?

Albert Regis is a Taurus, born May 17, 2003. Taurus runs Apr 20 - May 20 and is an Earth sign.

What is Albert Regis's moon sign?

Albert Regis has a Scorpio moon, calculated from his May 17, 2003 birthday. The moon describes how a player is wired when a play breaks down: Albert keeps score privately, files away every rep he lost, and collects on it later.

What is Albert Regis's mercury sign?

Albert Regis has Capricorn mercury, the placement that describes how he processes the game. Albert builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Albert Regis's mars sign?

Albert Regis has Sagittarius mars, which describes how the physical effort arrives. Albert plays with range, covering ground others need an extra step to reach.

How does being a Taurus show up in the trenches?

Taurus reads as: Immovable in the trenches; Grinds out the tough yards. For Albert Regis in the trenches with the Jacksonville Jaguars, that is the baseline the rest of the chart adjusts. In his case mars is in Sagittarius: Albert plays with range, covering ground others need an extra step to reach.

NFL stats

Defense · 1 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
202632020000000.0000000
Career32020000000.0000000