74Mekhi Becton
  • PositionGuard
  • Height6' 7"
  • Weight357 lbs
  • Age27
  • Experience7 yrs
  • CollegeLouisville
Green Bay Packers · Guard

Mekhi Becton

♈Aries sun · Mar 21 - Apr 19FireCosmic energy★★★★★

Mekhi Becton is a Aries, born April 18, 1999, with a Taurus moon and Capricorn mercury. Expect early aggression and a hot start before the whistle even settles.

Sun♈AriesMoon♉TaurusMercury♑CapricornMars♎Libra
First off the ballFearless, sometimes recklessExpect early aggression and a hot start before the whistle even settles.Cosmic energy is just for fun.

Mekhi's matchups

Scored against all four placements, not just the sun

Best teammates

Travis GloverRG · Green Bay Packers · ♌ Leo88 Strong synergyJordan MorganLT · Green Bay Packers · ♌ Leo70 Workable chemistryAaron BanksLG · Green Bay Packers · ♍ Virgo69 Workable chemistry

Teammate frustrations

Anthony BeltonRT · Green Bay Packers · ♓ Pisces49 Crossed wiresSean RhyanC · Green Bay Packers · ♍ Virgo56 Crossed wiresMarShawn LloydRB · Green Bay Packers · ♑ Capricorn51 Crossed wires

Mortal enemies

Caleb BanksNT · Minnesota Vikings · ♓ Pisces45 Stars at warT.J. EdwardsMLB · Chicago Bears · ♌ Leo70 Uneasy orbitJack CampbellMLB · Detroit Lions · ♌ Leo79 Uneasy orbit

Mekhi's chart, read out

Mekhi Becton is an Aries, born April 18, 1999. That makes him a Cardinal Fire sign, Mar 21 - Apr 19. His chart reads Aries sun, Taurus moon, Capricorn mercury, Libra mars. Mekhi settles rather than spikes under pressure, holding the same tempo in the fourth quarter as the first. Mekhi builds the drive in sequence and rarely takes the shot before the setup is in place. Mekhi plays under control and balanced, rarely beaten by his own momentum. Read together, that is the shape of an Aries in the trenches for the Green Bay Packers.

Mekhi Becton: frequently asked

What is Mekhi Becton's zodiac sign?

Mekhi Becton is an Aries, born April 18, 1999. Aries runs Mar 21 - Apr 19 and is a Fire sign.

What is Mekhi Becton's moon sign?

Mekhi Becton has a Taurus moon, calculated from his April 18, 1999 birthday. The moon describes how a player is wired when a play breaks down: Mekhi settles rather than spikes under pressure, holding the same tempo in the fourth quarter as the first.

What is Mekhi Becton's mercury sign?

Mekhi Becton has Capricorn mercury, the placement that describes how he processes the game. Mekhi builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Mekhi Becton's mars sign?

Mekhi Becton has Libra mars, which describes how the physical effort arrives. Mekhi plays under control and balanced, rarely beaten by his own momentum.

How does being an Aries show up in the trenches?

Aries reads as: First off the ball; Fearless, sometimes reckless. For Mekhi Becton in the trenches with the Green Bay Packers, that is the baseline the rest of the chart adjusts. In his case mars is in Libra: Mekhi plays under control and balanced, rarely beaten by his own momentum.

NFL stats

Defense · 1 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
2020141100000000.0000000
Career141100000000.0000000