2Ennis Rakestraw Jr.
  • PositionCornerback
  • Height5' 11"
  • Weight192 lbs
  • Age24
  • Experience3 yrs
  • CollegeMissouri
Detroit Lions · Cornerback

Ennis Rakestraw Jr.

♊Gemini sun · May 21 - Jun 20AirCosmic energy★★★★★

Ennis Rakestraw Jr. is a Gemini, born June 5, 2002, with a Pisces moon and Capricorn mercury. Look for trick plays, motion, and a playbook that keeps defenses guessing.

Sun♊GeminiMoon♓PiscesMercury♑CapricornMars♊Gemini
Reads two routes at onceQuick to improviseLook for trick plays, motion, and a playbook that keeps defenses guessing.Cosmic energy is just for fun.

Ennis's matchups

Scored against all four placements, not just the sun

Best teammates

Chuck ClarkFS · Detroit Lions · ♈ Aries86 Strong synergyChristian MahoganyLG · Detroit Lions · ♎ Libra84 Strong synergyJameson WilliamsWR · Detroit Lions · ♈ Aries83 Strong synergy

Teammate frustrations

Sam LaPortaTE · Detroit Lions · ♑ Capricorn45 Stars at warBlake MillerRT · Detroit Lions · ♓ Pisces51 Crossed wiresJuice ScruggsC · Detroit Lions · ♑ Capricorn51 Crossed wires

Ennis's chart, read out

Ennis Rakestraw Jr. is a Gemini, born June 5, 2002. That makes him a Mutable Air sign, May 21 - Jun 20. His chart reads Gemini sun, Pisces moon, Capricorn mercury, Gemini mars. Ennis feels the flow of a game before the numbers show it, and plays the version of the down that is actually happening. Ennis builds the drive in sequence and rarely takes the shot before the setup is in place. Ennis wins with quickness and change of direction instead of raw force. Read together, that is the shape of a Gemini in the secondary for the Detroit Lions.

Ennis Rakestraw Jr.: frequently asked

What is Ennis Rakestraw Jr.'s zodiac sign?

Ennis Rakestraw Jr. is a Gemini, born June 5, 2002. Gemini runs May 21 - Jun 20 and is an Air sign.

What is Ennis Rakestraw Jr.'s moon sign?

Ennis Rakestraw Jr. has a Pisces moon, calculated from his June 5, 2002 birthday. The moon describes how a player is wired when a play breaks down: Ennis feels the flow of a game before the numbers show it, and plays the version of the down that is actually happening.

What is Ennis Rakestraw Jr.'s mercury sign?

Ennis Rakestraw Jr. has Capricorn mercury, the placement that describes how he processes the game. Ennis builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Ennis Rakestraw Jr.'s mars sign?

Ennis Rakestraw Jr. has Gemini mars, which describes how the physical effort arrives. Ennis wins with quickness and change of direction instead of raw force.

How does being a Gemini show up in the secondary?

Gemini reads as: Reads two routes at once; Quick to improvise. For Ennis Rakestraw Jr. in the secondary with the Detroit Lions, that is the baseline the rest of the chart adjusts. In his case mars is in Gemini: Ennis wins with quickness and change of direction instead of raw force.

NFL stats

Defense · 2 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
202486420000000.0000000
202638440100000.0002000
Career1114860100000.0002000