91Matt Henningsen
  • PositionDefensive End
  • Height6' 3"
  • Weight291 lbs
  • Age27
  • Experience4 yrs
  • CollegeWisconsin
Denver Broncos · Defensive End

Matt Henningsen

♋Cancer sun · Jun 21 - Jul 22WaterCosmic energy★★★★★

Matt Henningsen is a Cancer, born July 9, 1999, with a Taurus moon and Capricorn mercury. Home-field energy runs high; defenses rally around their own.

Sun♋CancerMoon♉TaurusMercury♑CapricornMars♏Scorpio
Protects the pocketPlays with heart at homeHome-field energy runs high; defenses rally around their own.Cosmic energy is just for fun.

Matt's matchups

Scored against all four placements, not just the sun

Best teammates

D.J. JonesNT · Denver Broncos · ♑ Capricorn74 Workable chemistryTalanoa HufangaSS · Denver Broncos · ♒ Aquarius69 Workable chemistryBrandon JonesFS · Denver Broncos · ♈ Aries66 Workable chemistry

Teammate frustrations

Courtland SuttonWR · Denver Broncos · ♎ Libra49 Crossed wiresJaylen WaddleWR · Denver Broncos · ♐ Sagittarius51 Crossed wiresGarett BollesLT · Denver Broncos · ♊ Gemini56 Crossed wires

Mortal enemies

Kahlil BensonRT · Kansas City Chiefs · ♌ Leo51 Crossed wiresDJ GlazeRT · Las Vegas Raiders · ♌ Leo60 Uneasy orbitTravis BurkeLT · Los Angeles Chargers · ♑ Capricorn73 Uneasy orbit

Matt's chart, read out

Matt Henningsen is a Cancer, born July 9, 1999. That makes him a Cardinal Water sign, Jun 21 - Jul 22. His chart reads Cancer sun, Taurus moon, Capricorn mercury, Scorpio mars. Matt settles rather than spikes under pressure, holding the same tempo in the fourth quarter as the first. Matt builds the drive in sequence and rarely takes the shot before the setup is in place. Matt finishes every rep through the whistle and plays with a grudge. Read together, that is the shape of a Cancer on the defensive front for the Denver Broncos.

Matt Henningsen: frequently asked

What is Matt Henningsen's zodiac sign?

Matt Henningsen is a Cancer, born July 9, 1999. Cancer runs Jun 21 - Jul 22 and is a Water sign.

What is Matt Henningsen's moon sign?

Matt Henningsen has a Taurus moon, calculated from his July 9, 1999 birthday. The moon describes how a player is wired when a play breaks down: Matt settles rather than spikes under pressure, holding the same tempo in the fourth quarter as the first.

What is Matt Henningsen's mercury sign?

Matt Henningsen has Capricorn mercury, the placement that describes how he processes the game. Matt builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Matt Henningsen's mars sign?

Matt Henningsen has Scorpio mars, which describes how the physical effort arrives. Matt finishes every rep through the whistle and plays with a grudge.

How does being a Cancer show up on the defensive front?

Cancer reads as: Protects the pocket; Plays with heart at home. For Matt Henningsen on the defensive front with the Denver Broncos, that is the baseline the rest of the chart adjusts. In his case mars is in Scorpio: Matt finishes every rep through the whistle and plays with a grudge.

NFL stats

Defense · 2 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
202217218131000000.00002.520
202317191090000000.0002200
Career344018221000000.00024.520