71Tytus Howard
  • PositionOffensive Tackle
  • Height6' 5"
  • Weight320 lbs
  • Age30
  • Experience8 yrs
  • CollegeAlabama State
Cleveland Browns · Offensive Tackle

Tytus Howard

♊Gemini sun · May 21 - Jun 20AirCosmic energy★★★★★

Tytus Howard is a Gemini, born May 23, 1996, with a Cancer moon and Capricorn mercury. Look for trick plays, motion, and a playbook that keeps defenses guessing.

Sun♊GeminiMoon♋CancerMercury♑CapricornMars♓Pisces
Reads two routes at onceQuick to improviseLook for trick plays, motion, and a playbook that keeps defenses guessing.Cosmic energy is just for fun.

Tytus's matchups

Scored against all four placements, not just the sun

Best teammates

Austin BarberRG · Cleveland Browns · ♉ Taurus49 Tense aspectsHarold Fannin Jr.TE · Cleveland Browns · ♋ Cancer57 Tense aspectsElgton JenkinsC · Cleveland Browns · ♑ Capricorn51 Tense aspects

Teammate frustrations

Deshaun WatsonQB · Cleveland Browns · ♍ Virgo63 Uneasy orbitSpencer FanoLT · Cleveland Browns · ♏ Scorpio59 Crossed wiresZion JohnsonLG · Cleveland Browns · ♏ Scorpio63 Uneasy orbit

Mortal enemies

Keeanu BentonNT · Pittsburgh Steelers · ♋ Cancer63 Uneasy orbitTravis JonesNT · Baltimore Ravens · ♎ Libra88 Surprisingly civilBarrett CarterMLB · Cincinnati Bengals · ♏ Scorpio56 Crossed wires

Tytus's chart, read out

Tytus Howard is a Gemini, born May 23, 1996. That makes him a Mutable Air sign, May 21 - Jun 20. His chart reads Gemini sun, Cancer moon, Capricorn mercury, Pisces mars. Tytus plays off the emotional temperature of the huddle and lifts noticeably in front of a home crowd. Tytus builds the drive in sequence and rarely takes the shot before the setup is in place. Tytus plays fluid and reactive, closing on the ball by instinct rather than assignment. Read together, that is the shape of a Gemini in the trenches for the Cleveland Browns.

Tytus Howard: frequently asked

What is Tytus Howard's zodiac sign?

Tytus Howard is a Gemini, born May 23, 1996. Gemini runs May 21 - Jun 20 and is an Air sign.

What is Tytus Howard's moon sign?

Tytus Howard has a Cancer moon, calculated from his May 23, 1996 birthday. The moon describes how a player is wired when a play breaks down: Tytus plays off the emotional temperature of the huddle and lifts noticeably in front of a home crowd.

What is Tytus Howard's mercury sign?

Tytus Howard has Capricorn mercury, the placement that describes how he processes the game. Tytus builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Tytus Howard's mars sign?

Tytus Howard has Pisces mars, which describes how the physical effort arrives. Tytus plays fluid and reactive, closing on the ball by instinct rather than assignment.

How does being a Gemini show up in the trenches?

Gemini reads as: Reads two routes at once; Quick to improvise. For Tytus Howard in the trenches with the Cleveland Browns, that is the baseline the rest of the chart adjusts. In his case mars is in Pisces: Tytus plays fluid and reactive, closing on the ball by instinct rather than assignment.

NFL stats

Defense · 2 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
202370000010000.0000000
2024160000010000.0000000
Career250000020000.0000000