46Jackson Kuwatch
  • PositionLinebacker
  • Height6' 4"
  • Weight232 lbs
  • Age23
  • ExperienceRookie
  • CollegeMiami (OH)
Carolina Panthers · Linebacker

Jackson Kuwatch

♉Taurus sun · Apr 20 - May 20EarthCosmic energy★★★★★

Jackson Kuwatch is a Taurus, born May 19, 2003, with a Sagittarius moon and Capricorn mercury. A week to lean on the run game and wear opponents down.

Sun♉TaurusMoon♐SagittariusMercury♑CapricornMars♐Sagittarius
Immovable in the trenchesGrinds out the tough yardsA week to lean on the run game and wear opponents down.Cosmic energy is just for fun.

Jackson's matchups

Scored against all four placements, not just the sun

Best teammates

Lee HunterNT · Carolina Panthers · ♋ Cancer79 Workable chemistryNick ScottFS · Carolina Panthers · ♉ Taurus71 Workable chemistryTre'von MoehrigSS · Carolina Panthers · ♊ Gemini51 Tense aspects

Teammate frustrations

Rasheed WalkerLT · Carolina Panthers · ♒ Aquarius45 Stars at warBryce YoungQB · Carolina Panthers · ♌ Leo49 Crossed wiresTetairoa McMillanWR · Carolina Panthers · ♈ Aries51 Crossed wires

Mortal enemies

Bucky IrvingRB · Tampa Bay Buccaneers · ♌ Leo54 Crossed wiresCade OttonTE · Tampa Bay Buccaneers · ♈ Aries55 Crossed wiresKyle Pitts Sr.TE · Atlanta Falcons · ♎ Libra59 Crossed wires

Jackson's chart, read out

Jackson Kuwatch is a Taurus, born May 19, 2003. That makes him a Fixed Earth sign, Apr 20 - May 20. His chart reads Taurus sun, Sagittarius moon, Capricorn mercury, Sagittarius mars. Jackson shakes off mistakes almost immediately, which keeps a bad first half from becoming a bad game. Jackson builds the drive in sequence and rarely takes the shot before the setup is in place. Jackson plays with range, covering ground others need an extra step to reach. Read together, that is the shape of a Taurus at linebacker for the Carolina Panthers.

Jackson Kuwatch: frequently asked

What is Jackson Kuwatch's zodiac sign?

Jackson Kuwatch is a Taurus, born May 19, 2003. Taurus runs Apr 20 - May 20 and is an Earth sign.

What is Jackson Kuwatch's moon sign?

Jackson Kuwatch has a Sagittarius moon, calculated from his May 19, 2003 birthday. The moon describes how a player is wired when a play breaks down: Jackson shakes off mistakes almost immediately, which keeps a bad first half from becoming a bad game.

What is Jackson Kuwatch's mercury sign?

Jackson Kuwatch has Capricorn mercury, the placement that describes how he processes the game. Jackson builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Jackson Kuwatch's mars sign?

Jackson Kuwatch has Sagittarius mars, which describes how the physical effort arrives. Jackson plays with range, covering ground others need an extra step to reach.

How does being a Taurus show up at linebacker?

Taurus reads as: Immovable in the trenches; Grinds out the tough yards. For Jackson Kuwatch at linebacker with the Carolina Panthers, that is the baseline the rest of the chart adjusts. In his case mars is in Sagittarius: Jackson plays with range, covering ground others need an extra step to reach.

NFL stats

Defense · 1 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
202643030000000.0000000
Career43030000000.0000000