70Roger Rosengarten
  • PositionOffensive Tackle
  • Height6' 5"
  • Weight316 lbs
  • Age24
  • Experience3 yrs
  • CollegeWashington
Baltimore Ravens · Offensive Tackle

Roger Rosengarten

♊Gemini sun · May 21 - Jun 20AirCosmic energy★★★★★

Roger Rosengarten is a Gemini, born June 3, 2002, with a Aquarius moon and Capricorn mercury. Look for trick plays, motion, and a playbook that keeps defenses guessing.

Sun♊GeminiMoon♒AquariusMercury♑CapricornMars♊Gemini
Reads two routes at onceQuick to improviseLook for trick plays, motion, and a playbook that keeps defenses guessing.Cosmic energy is just for fun.

Roger's matchups

Scored against all four placements, not just the sun

Best teammates

Olaivavega IoaneRG · Baltimore Ravens · ♈ Aries72 Workable chemistryCam JurgensC · Baltimore Ravens · ♌ Leo73 Workable chemistryMark AndrewsTE · Baltimore Ravens · ♍ Virgo49 Tense aspects

Teammate frustrations

Lamar JacksonQB · Baltimore Ravens · ♑ Capricorn45 Stars at warRonnie StanleyLT · Baltimore Ravens · ♓ Pisces45 Stars at warDerrick HenryRB · Baltimore Ravens · ♑ Capricorn51 Crossed wires

Mortal enemies

Keeanu BentonNT · Pittsburgh Steelers · ♋ Cancer57 Crossed wiresCarson SchwesingerMLB · Cleveland Browns · ♓ Pisces49 Crossed wiresBarrett CarterMLB · Cincinnati Bengals · ♏ Scorpio51 Crossed wires

Roger's chart, read out

Roger Rosengarten is a Gemini, born June 3, 2002. That makes him a Mutable Air sign, May 21 - Jun 20. His chart reads Gemini sun, Aquarius moon, Capricorn mercury, Gemini mars. Roger detaches from the noise and sees the down as a problem to solve rather than a fight to win. Roger builds the drive in sequence and rarely takes the shot before the setup is in place. Roger wins with quickness and change of direction instead of raw force. Read together, that is the shape of a Gemini in the trenches for the Baltimore Ravens.

Roger Rosengarten: frequently asked

What is Roger Rosengarten's zodiac sign?

Roger Rosengarten is a Gemini, born June 3, 2002. Gemini runs May 21 - Jun 20 and is an Air sign.

What is Roger Rosengarten's moon sign?

Roger Rosengarten has an Aquarius moon, calculated from his June 3, 2002 birthday. The moon describes how a player is wired when a play breaks down: Roger detaches from the noise and sees the down as a problem to solve rather than a fight to win.

What is Roger Rosengarten's mercury sign?

Roger Rosengarten has Capricorn mercury, the placement that describes how he processes the game. Roger builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Roger Rosengarten's mars sign?

Roger Rosengarten has Gemini mars, which describes how the physical effort arrives. Roger wins with quickness and change of direction instead of raw force.

How does being a Gemini show up in the trenches?

Gemini reads as: Reads two routes at once; Quick to improvise. For Roger Rosengarten in the trenches with the Baltimore Ravens, that is the baseline the rest of the chart adjusts. In his case mars is in Gemini: Roger wins with quickness and change of direction instead of raw force.

NFL stats

Defense · 1 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
2024171010000000.0000000
Career171010000000.0000000