56Darius Robinson
  • PositionDefensive End
  • Height6' 5"
  • Weight290 lbs
  • Age25
  • Experience3 yrs
  • CollegeMissouri
Arizona Cardinals · Defensive End

Darius Robinson

♍Virgo sun · Aug 23 - Sep 22EarthCosmic energy★★★★★

Darius Robinson is a Virgo, born September 13, 2001, with a Gemini moon and Capricorn mercury. Disciplined, low-penalty football and clean route running rule the week.

Sun♍VirgoMoon♊GeminiMercury♑CapricornMars♑Capricorn
Surgical with assignmentsSweats the film detailsDisciplined, low-penalty football and clean route running rule the week.Cosmic energy is just for fun.

Darius's matchups

Scored against all four placements, not just the sun

Best teammates

Mack Wilson Sr.MLB · Arizona Cardinals · ♒ Aquarius51 Tense aspectsBudda BakerSS · Arizona Cardinals · ♑ Capricorn86 Strong synergyAndrew WingardFS · Arizona Cardinals · ♐ Sagittarius56 Tense aspects

Teammate frustrations

Jeremiyah LoveRB · Arizona Cardinals · ♊ Gemini49 Crossed wiresJon Gaines IIRG · Arizona Cardinals · ♊ Gemini51 Crossed wiresHjalte FroholdtC · Arizona Cardinals · ♌ Leo56 Crossed wires

Mortal enemies

Warren McClendon Jr.RT · Los Angeles Rams · ♈ Aries51 Crossed wiresColton McKivitzRT · San Francisco 49ers · ♌ Leo57 Crossed wiresCharles CrossLT · Seattle Seahawks · ♐ Sagittarius64 Uneasy orbit

Darius's chart, read out

Darius Robinson is a Virgo, born September 13, 2001. That makes him a Mutable Earth sign, Aug 23 - Sep 22. His chart reads Virgo sun, Gemini moon, Capricorn mercury, Capricorn mars. Darius processes out loud and adjusts mid-rep, which reads as restlessness until the adjustment works. Darius builds the drive in sequence and rarely takes the shot before the setup is in place. Darius grinds and outlasts, wearing down an opponent across four quarters rather than one snap. Read together, that is the shape of a Virgo on the defensive front for the Arizona Cardinals.

Darius Robinson: frequently asked

What is Darius Robinson's zodiac sign?

Darius Robinson is a Virgo, born September 13, 2001. Virgo runs Aug 23 - Sep 22 and is an Earth sign.

What is Darius Robinson's moon sign?

Darius Robinson has a Gemini moon, calculated from his September 13, 2001 birthday. The moon describes how a player is wired when a play breaks down: Darius processes out loud and adjusts mid-rep, which reads as restlessness until the adjustment works.

What is Darius Robinson's mercury sign?

Darius Robinson has Capricorn mercury, the placement that describes how he processes the game. Darius builds the drive in sequence and rarely takes the shot before the setup is in place.

What is Darius Robinson's mars sign?

Darius Robinson has Capricorn mars, which describes how the physical effort arrives. Darius grinds and outlasts, wearing down an opponent across four quarters rather than one snap.

How does being a Virgo show up on the defensive front?

Virgo reads as: Surgical with assignments; Sweats the film details. For Darius Robinson on the defensive front with the Arizona Cardinals, that is the baseline the rest of the chart adjusts. In his case mars is in Capricorn: Darius grinds and outlasts, wearing down an opponent across four quarters rather than one snap.

NFL stats

Defense · 3 seasons + career

SeasonGPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
2024610461000000.0000220
2025154315281010000.00005.570
2026614771000000.00000.500
Career266726413010000.0000890